Comparing 3608254 FitnessBrowser__Dino:3608254 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 78% coverage: 21:252/298 of query aligns to 16:254/265 of P07821
5x40A Structure of a cbio dimer bound with amppcp (see paper)
33% identity, 77% coverage: 9:238/298 of query aligns to 2:229/280 of 5x40A
O65934 ABC transporter ATP-binding/permease protein Rv1747; EC 7.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
34% identity, 70% coverage: 14:223/298 of query aligns to 318:525/865 of O65934
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
29% identity, 79% coverage: 15:248/298 of query aligns to 3:235/240 of 6mjpA
8bmpA Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
32% identity, 76% coverage: 22:247/298 of query aligns to 11:238/278 of 8bmpA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
30% identity, 71% coverage: 18:228/298 of query aligns to 7:220/226 of 5xu1B
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
31% identity, 79% coverage: 15:248/298 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
31% identity, 79% coverage: 15:248/298 of query aligns to 3:235/238 of 6s8gA
5d3mA Folate ecf transporter: amppnp bound state (see paper)
33% identity, 77% coverage: 20:247/298 of query aligns to 11:241/280 of 5d3mA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
31% identity, 79% coverage: 15:248/298 of query aligns to 3:235/235 of 6mhzA
8ee6A Cryo-em structure of human abca7 in pe/ch nanodiscs (see paper)
30% identity, 69% coverage: 18:223/298 of query aligns to 1501:1703/1808 of 8ee6A
Sites not aligning to the query:
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
33% identity, 74% coverage: 15:234/298 of query aligns to 3:222/233 of 6b8bA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
33% identity, 74% coverage: 15:234/298 of query aligns to 3:222/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
33% identity, 74% coverage: 15:234/298 of query aligns to 3:222/234 of 4p31A
6mbnA Lptb e163q in complex with atp (see paper)
30% identity, 79% coverage: 15:248/298 of query aligns to 4:236/241 of 6mbnA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 74% coverage: 23:244/298 of query aligns to 7:231/240 of 4ymuJ
8eopA Cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state (see paper)
29% identity, 69% coverage: 18:223/298 of query aligns to 1455:1657/1687 of 8eopA
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 73% coverage: 28:244/298 of query aligns to 15:231/241 of 4u00A
Sites not aligning to the query:
8bmsA Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
32% identity, 73% coverage: 30:247/298 of query aligns to 19:238/278 of 8bmsA
Sites not aligning to the query:
7w79A Heme exporter hrtba in complex with mn-amppnp (see paper)
35% identity, 68% coverage: 21:223/298 of query aligns to 11:210/216 of 7w79A
Sites not aligning to the query:
>3608254 FitnessBrowser__Dino:3608254
MPEAAAIETPVPIGLRARGVTVTYRNGLTALNDASFEIPQGSITALVGVNGAGKSTLFKA
IMGFVPVAKGEIEVMGGTVAAALKANKIAYVPQNEEVDWSFPVLVEDVVMMGRYGHMGLL
RIPSAKDRQAVQEALARVGMAEFRTRQIGELSGGQRKRVFLARALAQNGQVILLDEPFTG
VDVQTEEAIIALLRDLRDEGRVMLVSTHNLGSVPEFCDRTILMKGTVLGYGPTETTFTQA
NLERAFGGVLRHFVLEGADLHDDDDARKVMIFTDDERPLVTYDEKTRTLTSPDEGDTR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory