Comparing 3608427 FitnessBrowser__Dino:3608427 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
D7BAR0 Glucosylglycerate phosphorylase; GGa phosphorylase; GGaP; EC 2.4.1.352 from Allomeiothermus silvanus (strain ATCC 700542 / DSM 9946 / NBRC 106475 / NCIMB 13440 / VI-R2) (Thermus silvanus) (see paper)
45% identity, 89% coverage: 61:583/587 of query aligns to 47:553/555 of D7BAR0
P10249 Sucrose phosphorylase; Glucosyltransferase-A; GTF-A; Sucrose glucosyltransferase; EC 2.4.1.7 from Streptococcus mutans serotype c (strain ATCC 700610 / UA159) (see paper)
28% identity, 74% coverage: 66:502/587 of query aligns to 7:429/481 of P10249
Sites not aligning to the query:
D9TT09 Sucrose 6(F)-phosphate phosphorylase; Sucrose 6'-phosphate phosphorylase; SPP; EC 2.4.1.329 from Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIMB 9385 / NCA 3814 / NCTC 13789 / WDCM 00135 / 2032) (Clostridium thermosaccharolyticum) (see 2 papers)
28% identity, 74% coverage: 68:503/587 of query aligns to 9:437/488 of D9TT09
3czkA Crystal structure analysis of sucrose hydrolase(suh) e322q-sucrose complex (see paper)
28% identity, 87% coverage: 76:583/587 of query aligns to 100:615/618 of 3czkA
7znpA Structure of amedsp
28% identity, 74% coverage: 68:502/587 of query aligns to 8:442/502 of 7znpA
3uerA Crystal structure of amylosucrase from deinococcus geothermalis in complex with turanose (see paper)
25% identity, 87% coverage: 76:584/587 of query aligns to 110:649/651 of 3uerA
7xdqA Crystal structure of a glucosylglycerol phosphorylase mutant from marinobacter adhaerens
30% identity, 74% coverage: 68:502/587 of query aligns to 7:417/470 of 7xdqA
E4PMA5 Glucosylglycerol phosphorylase; GGoP; 2-O-alpha-D-glucopyranosylglycerol:phosphate alpha-D-glucosyltransferase; 2-O-alpha-D-glucosylglycerol phosphorylase (retaining); EC 2.4.1.359 from Marinobacter adhaerens (strain DSM 23420 / HP15) (see paper)
29% identity, 74% coverage: 68:502/587 of query aligns to 9:427/480 of E4PMA5
A0ZZH6 Sucrose phosphorylase; SP; SPase; EC 2.4.1.7 from Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) (see paper)
27% identity, 78% coverage: 68:522/587 of query aligns to 7:455/504 of A0ZZH6
2gduA E232q mutant of sucrose phosphorylase from bifidobacterium adolescentis in complex with sucrose (see paper)
27% identity, 78% coverage: 68:522/587 of query aligns to 7:455/504 of 2gduA
5c8bB Structural insights into the redesign of a sucrose phosphorylase by induced loop repositioning (see paper)
27% identity, 78% coverage: 68:522/587 of query aligns to 7:455/504 of 5c8bB
5m9xB Structure of sucrose phosphorylase from bifidobacterium adolescentis bound to glycosylated resveratrol (see paper)
27% identity, 78% coverage: 68:522/587 of query aligns to 7:455/504 of 5m9xB
Q9ZEU2 Amylosucrase; EC 2.4.1.4 from Neisseria polysaccharea (see 2 papers)
25% identity, 82% coverage: 101:583/587 of query aligns to 138:633/636 of Q9ZEU2
3ueqA Crystal structure of amylosucrase from neisseria polysaccharea in complex with turanose (see paper)
25% identity, 82% coverage: 101:583/587 of query aligns to 134:629/632 of 3ueqA
1s46A Covalent intermediate of the e328q amylosucrase mutant (see paper)
25% identity, 82% coverage: 101:583/587 of query aligns to 130:625/628 of 1s46A
1jgiA Crystal structure of the active site mutant glu328gln of amylosucrase from neisseria polysaccharea in complex with the natural substrate sucrose (see paper)
25% identity, 82% coverage: 101:583/587 of query aligns to 130:625/628 of 1jgiA
5x7uA Trehalose synthase from thermobaculum terrenum (see paper)
28% identity, 45% coverage: 91:357/587 of query aligns to 36:311/546 of 5x7uA
Sites not aligning to the query:
5gtwA The n253r mutant structures of trehalose synthase from deinococcus radiodurans display two different active-site conformations
27% identity, 48% coverage: 91:370/587 of query aligns to 35:327/548 of 5gtwA
Sites not aligning to the query:
5ykbD The n253f mutant structure of trehalose synthase from deinococcus radiodurans reveals an open active-site conformation (see paper)
27% identity, 48% coverage: 91:370/587 of query aligns to 35:303/523 of 5ykbD
Sites not aligning to the query:
A0R6E0 Trehalose synthase/amylase TreS; Maltose alpha-D-glucosyltransferase; MTase; EC 3.2.1.1; EC 5.4.99.16 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see 2 papers)
26% identity, 52% coverage: 53:357/587 of query aligns to 26:346/593 of A0R6E0
>3608427 FitnessBrowser__Dino:3608427
MTELKPLRKPTQTLSVRLSELLRQIYPDLNTDILSSQVLDAFFPEGTGRRKRARTPGNNL
WSEHDAVLITYGNSLMDGVHKPLDLLHDFLVEYLKGVVNGVHILPFFPFTSDDGFAVTDY
RAVNPTLGDWPDINRIADEFLLMSDLVLNHVSSQGAWFNAYRQGHAPYDRFFFEASPEDD
LSDVVRPRTTPLLQQVETANGPRHVWCTFSHDQIDLDFRNPEVLLEFLRIMRLHIDNGVR
IIRLDAVAFIWKVIGTPSIHLPQTHAIVRLMRLLCDFAQEPVILLTETNVPNAENLSYFG
NRNEAHAVYNFTLPPLVLHAMMSGTATYLNRWSTGMPPAQLGCAYLNFTASHDGIGMRPA
EGVLPEDEKARVIDTVRDLGGLVSMRALPGGGESPYELNITFFEAMGATYKGRDDYQVAR
FLCSQTIVMSLEGIPAFYIHSMLATPNDHDQVTRRGMNRAINRHNWDYPHLKALLHDPDT
VQAQVLGALSDRLRLRARQSAFHPNATQFTLQLDPRIFGVWRQSLDRHQSIFALHNVSDE
TVVVSPAAINLIEGEGWHDLLSGEAIRNGGAEIVLAPYQCRWISNRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory