Comparing 3608577 FitnessBrowser__Dino:3608577 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
34% identity, 99% coverage: 1:323/325 of query aligns to 9:324/330 of 7ug8B
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
34% identity, 92% coverage: 23:320/325 of query aligns to 26:320/337 of 2hzlB
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
34% identity, 92% coverage: 23:320/325 of query aligns to 54:348/365 of Q3J1R2
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
34% identity, 94% coverage: 13:316/325 of query aligns to 16:317/329 of 4petA
5cm6A Crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate
34% identity, 95% coverage: 13:320/325 of query aligns to 15:320/331 of 5cm6A
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
31% identity, 96% coverage: 9:320/325 of query aligns to 9:321/344 of 4yicA
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
28% identity, 88% coverage: 22:306/325 of query aligns to 23:314/330 of 2zzwA
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
28% identity, 88% coverage: 22:306/325 of query aligns to 23:314/330 of 2zzvA
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
28% identity, 88% coverage: 22:306/325 of query aligns to 54:345/361 of Q5SK82
Sites not aligning to the query:
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
25% identity, 88% coverage: 24:309/325 of query aligns to 23:306/315 of 4pe3A
7e9yA Crystal structure of elacco1 (see paper)
29% identity, 50% coverage: 22:182/325 of query aligns to 23:182/563 of 7e9yA
Sites not aligning to the query:
5i7iB Crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157) in complex with co-crystallized 3-hydroxybenzoate
27% identity, 66% coverage: 31:245/325 of query aligns to 34:246/320 of 5i7iB
5izzA Crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157, triple surface mutant k158a_k223a_k313a) in complex with metahydroxyphenylacetate, thermal exchange of ligand
27% identity, 66% coverage: 31:245/325 of query aligns to 32:244/318 of 5izzA
4pcdA Crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans och 114 (rd1_1052, target efi-510238) with bound l-galactonate (see paper)
25% identity, 68% coverage: 22:242/325 of query aligns to 25:241/300 of 4pcdA
4pc9A Crystal structure of a trap periplasmic solute binding protein from rosenbacter denitrificans och 114 (rd1_1052, target efi-510238) with bound d-mannonate (see paper)
25% identity, 68% coverage: 22:242/325 of query aligns to 25:241/300 of 4pc9A
Sites not aligning to the query:
Q16BC9 Solute-binding protein RD1_1052 from Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) (see paper)
25% identity, 68% coverage: 22:242/325 of query aligns to 49:265/325 of Q16BC9
4napD Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634), target efi-510102, with bound d-tryptophan (see paper)
21% identity, 86% coverage: 24:303/325 of query aligns to 24:301/310 of 4napD
Sites not aligning to the query:
4pgpA Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634, target efi-510120) with bound 3-indole acetic acid (see paper)
21% identity, 86% coverage: 24:303/325 of query aligns to 24:301/308 of 4pgpA
Sites not aligning to the query:
4pgnA Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634, target efi-510120) with bound indole pyruvate (see paper)
21% identity, 86% coverage: 24:303/325 of query aligns to 24:301/308 of 4pgnA
Sites not aligning to the query:
7ntdAAA TRAP dicarboxylate transporter-DctP subunit (see paper)
25% identity, 66% coverage: 25:238/325 of query aligns to 27:238/322 of 7ntdAAA
Sites not aligning to the query:
>3608577 FitnessBrowser__Dino:3608577
MLLKTPIAFSTALPGLGTPIPRVADALATMSGGTLKMKVYEPGKLVPAFEILDAVSSGKI
NSGYTTAGYWAGKIPAAPLFSAVPFGPEAGEYMAWLYYGNGMDLYQEMYDQAGYNVHVLP
CAILAPETSGWFAKEITSAEDLNGLKMRFFGLGGKVMQKLGVATSLLPGGEIFPALEKGA
IDATEFSMPAIDARLGFHKLVKFNYFPGWHQQATVFELMINKDVWNDASEQHKAIIESAC
KASMADSFAEGEAIQHAALIDNVEKNGVEMKQWSPEMLELFRATWDEVAAEEAANDEFFA
KVLADMTTFRDGYALWKRNAFLPRD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory