Comparing 3608636 FitnessBrowser__Dino:3608636 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1jftA Purine repressor mutant-hypoxanthine-purf operator complex (see paper)
32% identity, 94% coverage: 20:349/352 of query aligns to 2:335/340 of 1jftA
2puaA Crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices (see paper)
32% identity, 94% coverage: 20:349/352 of query aligns to 2:335/339 of 2puaA
2pubA Crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices (see paper)
32% identity, 94% coverage: 20:349/352 of query aligns to 1:334/338 of 2pubA
1wetA Structure of the purr-guanine-purf operator complex (see paper)
32% identity, 94% coverage: 20:349/352 of query aligns to 1:334/338 of 1wetA
P0ACP7 HTH-type transcriptional repressor PurR; Pur regulon repressor; Purine nucleotide synthesis repressor from Escherichia coli (strain K12) (see 5 papers)
32% identity, 94% coverage: 20:349/352 of query aligns to 3:336/341 of P0ACP7
Sites not aligning to the query:
1rzrG Crystal structure of transcriptional regulator- phosphoprotein-DNA complex (see paper)
30% identity, 87% coverage: 20:326/352 of query aligns to 4:310/332 of 1rzrG
1rzrA Crystal structure of transcriptional regulator- phosphoprotein-DNA complex (see paper)
30% identity, 87% coverage: 20:326/352 of query aligns to 4:310/332 of 1rzrA
3oqoA Ccpa-hpr-ser46p-syn cre (see paper)
28% identity, 87% coverage: 20:326/352 of query aligns to 4:310/333 of 3oqoA
Sites not aligning to the query:
2jcgA Apo form of the catabolite control protein a (ccpa) from bacillus megaterium, with the DNA binding domain (see paper)
28% identity, 87% coverage: 20:326/352 of query aligns to 2:300/322 of 2jcgA
5yszA Transcriptional regulator celr-cellobiose complex (see paper)
30% identity, 93% coverage: 19:345/352 of query aligns to 2:326/327 of 5yszA
2nzvG Structural mechanism for the fine-tuning of ccpa function by the small molecule effectors g6p and fbp (see paper)
25% identity, 72% coverage: 74:326/352 of query aligns to 1:253/275 of 2nzvG
2nzuG Structural mechanism for the fine-tuning of ccpa function by the small molecule effectors g6p and fbp (see paper)
25% identity, 72% coverage: 74:326/352 of query aligns to 1:253/275 of 2nzuG
1sxgB Structural studies on the apo transcription factor form b. Megaterium (see paper)
25% identity, 71% coverage: 76:326/352 of query aligns to 1:251/273 of 1sxgB
1lbgA Lactose operon repressor bound to 21-base pair symmetric operator DNA, alpha carbons only (see paper)
29% identity, 95% coverage: 20:352/352 of query aligns to 5:336/357 of 1lbgA
1efaA Crystal structure of the lac repressor dimer bound to operator and the anti-inducer onpf (see paper)
29% identity, 93% coverage: 20:345/352 of query aligns to 4:327/328 of 1efaA
2pe5A Crystal structure of the lac repressor bound to onpg in repressed state (see paper)
29% identity, 93% coverage: 20:345/352 of query aligns to 4:327/328 of 2pe5A
2o20B Crystal structure of transcription regulator ccpa of lactococcus lactis (see paper)
26% identity, 78% coverage: 71:345/352 of query aligns to 1:273/275 of 2o20B
3k4hA Crystal structure of putative transcriptional regulator laci from bacillus cereus subsp. Cytotoxis nvh 391-98
26% identity, 70% coverage: 76:321/352 of query aligns to 2:252/282 of 3k4hA
P36673 HTH-type transcriptional regulator TreR; Trehalose operon repressor from Escherichia coli (strain K12) (see paper)
25% identity, 90% coverage: 20:336/352 of query aligns to 6:310/315 of P36673
4rk1D Crystal structure of laci family transcriptional regulator from enterococcus faecium, target efi-512930, with bound ribose
27% identity, 70% coverage: 77:321/352 of query aligns to 1:239/269 of 4rk1D
>3608636 FitnessBrowser__Dino:3608636
MVDRTTNRRVARKPATPSPTLQDVAQAAGVSTATVSRCLNSPELVVEQTRERVLAVVQEL
GYAPNFGARALAAKRTNTIGAIIPTMENAIFARGLQAFQEELARHGLTLLVASSSYSPKL
EEEQIRTLLARGADALLLIGFERSARAYELLQQRGVPYVIAWAYSAGSDHHAIGFDNRAA
MRALARQVFGLGHRDVAIIAAPMDSNDRARERVLGIWDAAAEVGLDRDALTLVQTPYSIE
NGARVMAEILAGPRQPTAVMCGNDVLAVGAMGAARAAGLSVPGDLSITGFDDIEIAGIVT
PGLTTVHVPHRQMGIEAARVLATLLSGGAPPVPLLLETQIISRASLGPVSGT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory