Comparing 3608695 FitnessBrowser__Dino:3608695 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wbtA Crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate
56% identity, 97% coverage: 8:366/372 of query aligns to 9:365/369 of 4wbtA
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
31% identity, 86% coverage: 38:358/372 of query aligns to 35:352/360 of 8bj3A
Sites not aligning to the query:
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
33% identity, 94% coverage: 8:356/372 of query aligns to 4:340/353 of 4r5zA
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
33% identity, 94% coverage: 8:356/372 of query aligns to 4:340/353 of 4r2nA
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
29% identity, 85% coverage: 39:356/372 of query aligns to 31:352/366 of 3cq5B
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
29% identity, 85% coverage: 39:356/372 of query aligns to 29:350/364 of 3cq6A
Sites not aligning to the query:
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
30% identity, 79% coverage: 39:331/372 of query aligns to 31:335/369 of 4r8dA
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
28% identity, 94% coverage: 14:362/372 of query aligns to 2:345/354 of 3ly1D
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
27% identity, 81% coverage: 67:368/372 of query aligns to 53:351/353 of 7szpA
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
27% identity, 78% coverage: 80:368/372 of query aligns to 66:351/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
27% identity, 78% coverage: 80:368/372 of query aligns to 66:351/354 of 1fg3A
Sites not aligning to the query:
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
27% identity, 77% coverage: 80:366/372 of query aligns to 52:335/335 of 1geyA
Sites not aligning to the query:
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
29% identity, 59% coverage: 89:308/372 of query aligns to 78:284/335 of Q9X0D0
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
29% identity, 59% coverage: 89:308/372 of query aligns to 79:285/335 of 2f8jA
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
29% identity, 59% coverage: 89:308/372 of query aligns to 72:278/328 of 1uu0A
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
29% identity, 59% coverage: 89:308/372 of query aligns to 73:279/329 of 1uu1A
Sites not aligning to the query:
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
29% identity, 59% coverage: 89:308/372 of query aligns to 73:279/329 of 1h1cA
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
23% identity, 85% coverage: 49:366/372 of query aligns to 52:375/384 of 1o4sB
P0DV65 L-serine phosphate decarboxylase; CobD homolog SMUL_1544; SmCobD; L-serine O-phosphate decarboxylase; L-Ser-P decarboxylase; Norcobamide biosynthesis protein SMUL_1544; Threonine phosphate decarboxylase-like enzyme; EC 4.1.1.- from Sulfurospirillum multivorans (strain DM 12446 / JCM 15788 / NBRC 109480) (see paper)
24% identity, 76% coverage: 71:353/372 of query aligns to 82:375/392 of P0DV65
Sites not aligning to the query:
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
28% identity, 70% coverage: 12:270/372 of query aligns to 8:285/400 of Q02635
>3608695 FitnessBrowser__Dino:3608695
MTHTPGPRFTPLAQSLPATVPFVGPETQERARGRPFAARLGANESAFGPSPRAVAAMAEA
ATGAWMYGDPESHDLRAALAAHHRVGMENVIVGEGIDGLLGYLVRLLVAPGDTVVTSAGA
YPTFNYHVAGFGGTLHAVPYRDDHEDPQALLDMARAVDAKAIYLANPDNPMGSWHAAGVI
TDMIDALPPGCLLLLDEAYIELAPDGTAPEIAPDDPRVIRLRTFSKARGLAGARVGYGIA
APGLISAFGKVRNHFGMSRVSQAAALAALQDSDHLAKVVAKTAAARTRIAEIGAAHGLRA
LPSATNFVTLDCGGDGARAKAILEALIARDIFVRMPFVAPQDRCIRISCGTPEMLDLLAE
RLPDALAAATKP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory