Comparing 3609057 FitnessBrowser__Dino:3609057 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q1JUQ0 L-2-keto-3-deoxyarabonate dehydratase; L-KDA dehydratase; 2-dehydro-3-deoxy-L-arabinonate dehydratase; L-2-keto-3-deoxyarabinonate dehydratase; EC 4.2.1.43 from Azospirillum brasilense (see paper)
57% identity, 99% coverage: 4:302/303 of query aligns to 9:308/309 of Q1JUQ0
Sites not aligning to the query:
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
38% identity, 53% coverage: 6:165/303 of query aligns to 5:163/291 of 3na8A
Sites not aligning to the query:
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
32% identity, 50% coverage: 4:155/303 of query aligns to 3:153/298 of 4ptnA
Sites not aligning to the query:
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
32% identity, 50% coverage: 4:155/303 of query aligns to 3:153/298 of 4onvA
Sites not aligning to the query:
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
32% identity, 50% coverage: 4:155/303 of query aligns to 3:153/298 of 4oe7D
Sites not aligning to the query:
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
32% identity, 50% coverage: 4:155/303 of query aligns to 3:153/298 of 4oe7B
Sites not aligning to the query:
4oe7A Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
32% identity, 50% coverage: 4:155/303 of query aligns to 3:153/298 of 4oe7A
Sites not aligning to the query:
3nevA Crystal structure of yage, a prophage protein from e. Coli k12 in complex with kdgal (see paper)
32% identity, 50% coverage: 4:155/303 of query aligns to 3:153/298 of 3nevA
Sites not aligning to the query:
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
29% identity, 55% coverage: 13:178/303 of query aligns to 11:177/291 of 4dxvA
Sites not aligning to the query:
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
29% identity, 55% coverage: 13:178/303 of query aligns to 11:177/291 of 3u8gA
Sites not aligning to the query:
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
29% identity, 55% coverage: 13:178/303 of query aligns to 11:177/291 of 3tdfA
Sites not aligning to the query:
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
29% identity, 55% coverage: 13:178/303 of query aligns to 11:177/291 of 3tceA
Sites not aligning to the query:
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
29% identity, 55% coverage: 13:178/303 of query aligns to 11:177/291 of 3rk8A
Sites not aligning to the query:
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
29% identity, 55% coverage: 13:178/303 of query aligns to 11:177/291 of 3pueB
Sites not aligning to the query:
5c55A Crystal structure of the y138f mutant of c.Glutamicum n- acetylneuraminic acid lyase in complex with pyruvate
27% identity, 46% coverage: 3:142/303 of query aligns to 1:139/307 of 5c55A
Sites not aligning to the query:
3qfeA Crystal structures of a putative dihydrodipicolinate synthase family protein from coccidioides immitis
26% identity, 83% coverage: 6:258/303 of query aligns to 9:253/305 of 3qfeA
Sites not aligning to the query:
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
31% identity, 52% coverage: 4:162/303 of query aligns to 2:162/294 of 4i7wA
Sites not aligning to the query:
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
30% identity, 52% coverage: 4:162/303 of query aligns to 2:162/294 of Q8UGL3
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
24% identity, 95% coverage: 4:292/303 of query aligns to 3:286/295 of 1o5kA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
24% identity, 95% coverage: 4:292/303 of query aligns to 2:285/294 of Q9X1K9
>3609057 FitnessBrowser__Dino:3609057
MNTYSGIWPVAPTPFNEDGTLDLDGMKRVLDCLIDQGADGICVLANYSEQFLISDAEREV
LARLSVEHVAGRVPVIVTISHFATQIAVERARFAKDLGADIVMMMPPYHGALLKGTPEQS
FEQFAAVGEVGIPIMVQDAPLSGVDLPVDLLVRMAREIEAVKLFKIECPRAANKIRALIA
QGGAAIEGPFDGEEAITLLADLDAGATGTMTSGMIVDQIKPVLTRYHAGDVSGATEAYGR
VAMAIIHENRQCGWQSCKAAMVEGGVIASEFCRHPIAPLHPAIRARLIDLLRPLDPLVLR
WGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory