Comparing 3609740 FitnessBrowser__Dino:3609740 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
27% identity, 81% coverage: 32:294/326 of query aligns to 3:262/302 of 8hkbA
2f5xB Structure of periplasmic binding protein bugd (see paper)
24% identity, 90% coverage: 32:324/326 of query aligns to 5:296/300 of 2f5xB
7ndsA Crystal structure of tphc in a closed conformation (see paper)
27% identity, 66% coverage: 32:247/326 of query aligns to 3:214/294 of 7ndsA
Sites not aligning to the query:
7ndrD Crystal structure of tphc in an open conformation (see paper)
27% identity, 66% coverage: 32:247/326 of query aligns to 3:214/293 of 7ndrD
5okuA R. Palustris rpa4515 with adipate (see paper)
23% identity, 90% coverage: 32:325/326 of query aligns to 5:296/299 of 5okuA
5oeiA R. Palustris rpa4515 with oxoadipate (see paper)
23% identity, 90% coverage: 32:325/326 of query aligns to 5:296/299 of 5oeiA
6hkeB Matc (rpa3494) from rhodopseudomonas palustris with bound malate (see paper)
26% identity, 77% coverage: 43:292/326 of query aligns to 15:259/296 of 6hkeB
Sites not aligning to the query:
>3609740 FitnessBrowser__Dino:3609740
MTLEFTRRTLIAAAAALAMTGGAHAEGEQMLESIHFLIPGGAGGGWDGTARGTGEALTKA
GLVGSASYENMSGGGGGKAIAYLIENANSSHGTLMVNSTPIVIRSLTGEISQSFRDLTLV
AGTIGDYAAIVVGKDSPINSMADLIAAYDADPNATAVGGGSVPGGMDHLVAAMVMEAAGK
DALGVKYIPYDAGGKAMAALLSGEIAALSTGFSEAIDLAEAGEVKIIGVTAPERVAAYDS
APTMVEQGIDTTFVNWRGFFAAPGLPEEQLAAYQATLEKMYDTPEWEEVRARNGWVNIHN
SGADFQSFLEAQEAQIGDLMKKLGFL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory