SitesBLAST
Comparing 5207514 FitnessBrowser__PV4:5207514 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
28% identity, 97% coverage: 3:231/235 of query aligns to 6:240/244 of P0A2C9
- M125 (≠ L120) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (≠ M216) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (vs. gap) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
5iz4A Crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans
26% identity, 96% coverage: 6:231/235 of query aligns to 8:243/247 of 5iz4A
- active site: G15 (≠ R13), S150 (≠ D134), S159 (≠ K143), Y163 (= Y147), K167 (= K151)
- binding adenosine-5'-diphosphate: G11 (= G9), S14 (≠ K12), G15 (≠ R13), I16 (= I14), F36 (≠ Y33), A63 (≠ C53), D64 (= D54), V65 (≠ F55), A92 (vs. gap), G93 (vs. gap), V117 (= V104)
Q8N4T8 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-[acyl-carrier-protein] reductase beta subunit; KAR beta subunit; Carbonyl reductase family member 4; CBR4; Quinone reductase CBR4; Short chain dehydrogenase/reductase family 45C member 1; EC 1.1.1.100; EC 1.6.5.10 from Homo sapiens (Human) (see 4 papers)
24% identity, 100% coverage: 1:234/235 of query aligns to 1:235/237 of Q8N4T8
- G9 (= G9) mutation to S: Unable to restore growth of an OAR1-deficient yeast mutant.
- SRGI 11:14 (≠ GKRI 11:14) binding
- R12 (≠ K12) mutation to A: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant.
- R34 (= R34) mutation to A: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant. Strongly reduces NADPH-dependent reductase activity with acetoacetyl-CoA and 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- RN 34:35 (≠ RS 34:35) binding
- D56 (= D54) binding
- L70 (= L68) to M: in dbSNP:rs2877380
- AAG 83:85 (≠ NAS 81:83) binding
- S135 (≠ D134) mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant.
- Y148 (= Y147) binding ; mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant.
- K152 (= K151) binding ; mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant. Abolishes NADPH-dependent reductase activity with acetoacetyl-CoA. Strongly reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- R168 (vs. gap) mutation to E: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant. Increases NADPH-dependent reductase activity with acetoacetyl-CoA. Reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- K169 (≠ P167) mutation to E: Unable to restore growth of an OAR1-deficient yeast mutant. Increases NADPH-dependent reductase activity with acetoacetyl-CoA. Reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- VHT 181:183 (≠ ICF 179:181) binding
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
27% identity, 97% coverage: 3:231/235 of query aligns to 9:239/243 of 4i08A
- active site: G19 (≠ R13), N113 (≠ H105), S141 (≠ D134), Q151 (≠ H144), Y154 (= Y147), K158 (= K151)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G9), S17 (≠ G11), R18 (≠ K12), I20 (= I14), T40 (≠ R34), N62 (≠ D54), V63 (≠ F55), N89 (= N81), A90 (= A82), G140 (≠ T133), S141 (≠ D134), Y154 (= Y147), K158 (= K151), P184 (= P176), G185 (≠ A177), T189 (≠ F181)
4cqmF Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD and NADP (see paper)
24% identity, 100% coverage: 1:234/235 of query aligns to 5:239/241 of 4cqmF
- active site: G17 (≠ R13), S139 (≠ D134), Q149 (≠ H144), Y152 (= Y147), K156 (= K151)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G9), R16 (≠ K12), G17 (≠ R13), I18 (= I14), A37 (≠ Y33), R38 (= R34), N39 (≠ S35), D60 (= D54), V61 (≠ F55), A87 (≠ N81), A88 (= A82), G89 (≠ S83), V137 (≠ I132), S139 (≠ D134), Y152 (= Y147), K156 (= K151), V185 (≠ I179), T187 (≠ F181), M189 (≠ E183)
5bt9C Crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with NADP (see paper)
28% identity, 98% coverage: 5:234/235 of query aligns to 10:242/250 of 5bt9C
- active site: R18 (= R13), I140 (= I132), Y155 (= Y147), K159 (= K151)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R18 (= R13), I19 (= I14), C38 (≠ Y33), N39 (≠ R34), R40 (≠ S35), S41 (≠ H36), L66 (= L61), E67 (= E62), N90 (= N81), S92 (= S83), I140 (= I132), K159 (= K151), P184 (= P176), G185 (≠ A177), T187 (≠ I179), L188 (≠ C180)
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
28% identity, 97% coverage: 3:231/235 of query aligns to 5:239/243 of 1q7bA
- active site: G15 (≠ R13), E101 (≠ V97), S137 (≠ D134), Q147 (≠ H144), Y150 (= Y147), K154 (= K151)
- binding calcium ion: E232 (≠ R224), T233 (≠ S225)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G9), S13 (≠ G11), R14 (≠ K12), T36 (≠ R34), N58 (≠ D54), V59 (≠ F55), N85 (= N81), A86 (= A82), G87 (≠ S83), I88 (≠ L84), S137 (≠ D134), Y150 (= Y147), K154 (= K151), P180 (= P176), G181 (≠ A177), I183 (= I179)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
28% identity, 97% coverage: 3:231/235 of query aligns to 6:240/244 of P0AEK2
- GASR 12:15 (≠ GVGK 9:12) binding
- T37 (≠ R34) binding
- NV 59:60 (≠ DF 54:55) binding
- N86 (= N81) binding
- Y151 (= Y147) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YAASK 147:151) binding
- A154 (≠ S150) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K151) mutation to A: Defect in the affinity for NADPH.
- I184 (= I179) binding
- E233 (≠ R224) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
28% identity, 97% coverage: 3:231/235 of query aligns to 5:239/243 of 7emgB
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
27% identity, 97% coverage: 3:231/235 of query aligns to 6:240/244 of 6t77A
- active site: G16 (≠ R13), S138 (≠ D134), Y151 (= Y147)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G9), S14 (≠ G11), R15 (≠ K12), T37 (≠ R34), L58 (≠ C53), N59 (≠ D54), V60 (≠ F55), A87 (= A82), G88 (≠ S83), I89 (≠ L84)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
26% identity, 98% coverage: 2:231/235 of query aligns to 5:240/244 of 6wprA
- active site: G16 (≠ R13), S138 (≠ D134), Y151 (= Y147)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G9), S14 (≠ G11), R15 (≠ K12), T37 (≠ R34), L58 (≠ C53), D59 (= D54), V60 (≠ F55), N86 (= N81), A87 (= A82), G88 (≠ S83), I89 (≠ L84), I136 (= I132), Y151 (= Y147), K155 (= K151), P181 (= P176)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
26% identity, 98% coverage: 2:231/235 of query aligns to 5:240/244 of 6t62A
- active site: G16 (≠ R13), S138 (≠ D134), Y151 (= Y147)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G9), S14 (≠ G11), R15 (≠ K12), A36 (≠ Y33), T37 (≠ R34), L58 (≠ C53), D59 (= D54), V60 (≠ F55), N86 (= N81), A87 (= A82), G88 (≠ S83), I89 (≠ L84), I136 (= I132), S137 (≠ T133), S138 (≠ D134), Y151 (= Y147), K155 (= K151), P181 (= P176), G182 (≠ A177), I184 (= I179), M188 (≠ H184)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
27% identity, 97% coverage: 3:231/235 of query aligns to 5:239/243 of 1q7cA
- active site: G15 (≠ R13), S137 (≠ D134), Q147 (≠ H144), F150 (≠ Y147), K154 (= K151)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G9), S13 (≠ G11), R14 (≠ K12), A35 (≠ Y33), T36 (≠ R34), L57 (≠ C53), N58 (≠ D54), V59 (≠ F55), G87 (≠ S83), I88 (≠ L84)
2bfmA Leishmania major pteridine reductase 1 in complex with NADP and trimethoprim (see paper)
27% identity, 97% coverage: 6:234/235 of query aligns to 5:263/266 of 2bfmA
- active site: R12 (= R13), D159 (= D134), Y172 (= Y147)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R12 (= R13), L13 (≠ I14), Y32 (= Y33), H33 (≠ R34), R34 (≠ S35), S35 (≠ H36), L61 (= L50), N97 (= N81), A98 (= A82), S99 (= S83), M157 (≠ I132), V158 (≠ T133), D159 (= D134), K176 (= K151), P202 (= P176), L204 (= L178), S205 (≠ I179)
- binding trimethoprim: F101 (≠ W85), L166 (≠ S141), Y172 (= Y147), L204 (= L178), H219 (≠ A193)
4qecA Elxo with NADP bound (see paper)
26% identity, 98% coverage: 1:231/235 of query aligns to 1:244/248 of 4qecA
- active site: G13 (≠ R13), N111 (≠ H105), S139 (≠ D134), Y152 (= Y147), K156 (= K151)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (= K12), G13 (≠ R13), I14 (= I14), S33 (≠ Y33), R34 (= R34), K38 (vs. gap), D59 (= D54), V60 (≠ F55), N86 (= N81), A87 (= A82), G88 (≠ S83), I137 (= I132), Y152 (= Y147), K156 (= K151), P182 (= P176), I185 (= I179)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
26% identity, 97% coverage: 3:231/235 of query aligns to 9:243/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G9), S17 (≠ G11), R18 (≠ K12), I20 (= I14), T40 (≠ R34), N62 (≠ D54), V63 (≠ F55), N89 (= N81), A90 (= A82), I92 (≠ L84), V139 (≠ I132), S141 (≠ D134), Y154 (= Y147), K158 (= K151), P184 (= P176), G185 (≠ A177), I187 (= I179), T189 (vs. gap), M191 (vs. gap)
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
26% identity, 99% coverage: 1:232/235 of query aligns to 3:250/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G9), S13 (≠ G11), R14 (≠ K12), G15 (≠ R13), I16 (= I14), L36 (≠ R34), R37 (≠ S35), N38 (≠ H36), A61 (≠ C53), D62 (= D54), V63 (≠ F55), N89 (= N81), A90 (= A82), G91 (≠ S83), T113 (≠ V104), V143 (≠ I132), S145 (≠ D134), Y159 (= Y147), K163 (= K151), P189 (= P176), G190 (≠ A177), I192 (= I179), T194 (≠ F181), I196 (≠ E183), H197 (= H184)
Q9S9W2 Short-chain dehydrogenase/reductase SDRA; Protein INDOLE-3-BUTYRIC ACID RESPONSE 1; Short-chain dehydrogenase/reductase A; EC 1.1.-.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 97% coverage: 3:231/235 of query aligns to 12:249/254 of Q9S9W2
- R43 (= R34) mutation to C: In ibr1-1; resistance to the inhibitory effect of intermediate levels of indole-3-butyric acid (IBA) on root elongation.
- S140 (≠ A125) mutation to F: In ibr1-8; resistance to the inhibitory effect of intermediate levels of indole-3-butyric acid (IBA) on root elongation.
6rxcA Leishmania major pteridine reductase 1 (lmptr1) in complex with inhibitor 4 (nmt-c0026) (see paper)
26% identity, 97% coverage: 6:234/235 of query aligns to 6:260/263 of 6rxcA
- active site: R13 (= R13), D159 (= D134), Y172 (= Y147)
- binding methyl 1-[4-[[2,4-bis(azanyl)pteridin-6-yl]methyl-(3-oxidanylpropyl)amino]phenyl]carbonylpiperidine-4-carboxylate: S100 (= S83), F102 (≠ W85), L166 (≠ S141), Y169 (≠ H144), Y172 (= Y147), L204 (= L178)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R13 (= R13), L14 (≠ I14), H32 (≠ T32), Y33 (= Y33), H34 (≠ R34), R35 (≠ S35), S36 (≠ H36), L62 (= L50), N98 (= N81), A99 (= A82), S100 (= S83), S101 (≠ L84), S124 (≠ V104), M157 (≠ I132), D159 (= D134), K176 (= K151), P202 (= P176), S205 (≠ I179)
4iinA Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 complexed with NAD+
26% identity, 97% coverage: 3:231/235 of query aligns to 7:233/236 of 4iinA
- active site: G17 (≠ R13), S143 (≠ D134), Y156 (= Y147), K160 (= K151)
- binding nicotinamide-adenine-dinucleotide: G13 (= G9), G17 (≠ R13), I18 (= I14), N36 (≠ T32), R38 (= R34), A65 (≠ F55), N91 (= N81), A92 (= A82), G93 (≠ S83), V141 (≠ I132), S143 (≠ D134), Y156 (= Y147), K160 (= K151), P186 (= P176)
Query Sequence
>5207514 FitnessBrowser__PV4:5207514
MQKTILITGVGKRIGLYLAEAFLTRGYKVIGTYRSHYPSIDALTKLGADLYPCDFTVQSQ
LEELIQTLKQNYRQLDAVIHNASLWLDDNDPAGADQVIAQMMQVHVYAPYQLNLALTPLL
QNQQAMTDIIHITDYVAQKGSKKHIAYAASKAALENMTLSFAAKLAPKVKVNAIAPALIC
FNEHDDAAYREKARAKSVLAREGGEVEVLQAIDYLMQSQYVTGRSLALDGGRQLK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory