SitesBLAST
Comparing 5208037 FitnessBrowser__PV4:5208037 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5mhaB D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
31% identity, 79% coverage: 61:302/308 of query aligns to 60:307/308 of 5mhaB
- binding 2-Ketohexanoic acid: R66 (≠ Y67), R226 (= R223), H274 (= H271), Y282 (≠ F277)
- binding (2R)-2-hydroxyhexanoic acid: R66 (≠ Y67), A67 (= A68), G68 (= G69), H91 (≠ F91), Y282 (≠ F277)
- binding magnesium ion: F212 (≠ L209), E213 (≠ A210), M215 (= M212), D243 (≠ P240)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A67 (= A68), G68 (= G69), T88 (≠ R88), L143 (≠ T140), G144 (= G141), T145 (≠ N142), L146 (≠ I143), R165 (≠ N162), R166 (= R163), S167 (≠ G164), P180 (≠ L177), T197 (≠ L194), P198 (= P195), T203 (= T200), V224 (≠ L221), A225 (≠ G222), R226 (= R223), H274 (= H271), S276 (≠ A273)
5mhaA D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
31% identity, 79% coverage: 61:302/308 of query aligns to 60:307/308 of 5mhaA
- binding 2-Ketohexanoic acid: R66 (≠ Y67), A67 (= A68), G68 (= G69), H91 (≠ F91), R226 (= R223), H274 (= H271), Y282 (≠ F277)
- binding magnesium ion: T132 (= T129), A134 (≠ Q131)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A67 (= A68), G68 (= G69), T88 (≠ R88), L143 (≠ T140), G144 (= G141), T145 (≠ N142), L146 (≠ I143), R165 (≠ N162), R166 (= R163), S167 (≠ G164), P180 (≠ L177), T197 (≠ L194), P198 (= P195), T203 (= T200), V224 (≠ L221), A225 (≠ G222), R226 (= R223), H274 (= H271), S276 (≠ A273)
5mh5A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-keto-hexanoic acid and NADP+ (1.4 a resolution)
31% identity, 79% coverage: 61:302/308 of query aligns to 60:307/308 of 5mh5A
- binding 2-Ketohexanoic acid: R66 (≠ Y67), A67 (= A68), G68 (= G69), H91 (≠ F91), R226 (= R223), H274 (= H271), Y282 (≠ F277)
- binding magnesium ion: T132 (= T129), A134 (≠ Q131), F212 (≠ L209), E213 (≠ A210), M215 (= M212), D243 (≠ P240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A67 (= A68), G68 (= G69), T88 (≠ R88), G142 (= G139), L143 (≠ T140), G144 (= G141), T145 (≠ N142), L146 (≠ I143), R165 (≠ N162), R166 (= R163), S167 (≠ G164), T197 (≠ L194), P198 (= P195), T203 (= T200), V224 (≠ L221), A225 (≠ G222), R226 (= R223), H274 (= H271), S276 (≠ A273)
5mh6A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-ketohexanoic acid and NAD+ (1.35 a resolution)
31% identity, 79% coverage: 61:302/308 of query aligns to 58:305/306 of 5mh6A
- binding 2-Ketohexanoic acid: R64 (≠ Y67), A65 (= A68), G66 (= G69), H89 (≠ F91), R224 (= R223), H272 (= H271), Y280 (≠ F277)
- binding magnesium ion: T130 (= T129), A132 (≠ Q131), F210 (≠ L209), E211 (≠ A210), M213 (= M212), G225 (= G224), P226 (≠ D225), V228 (≠ L227), E230 (≠ L229), D241 (≠ P240), S251 (≠ N250)
- binding nicotinamide-adenine-dinucleotide: A65 (= A68), G66 (= G69), T86 (≠ R88), H89 (≠ F91), G142 (= G141), T143 (≠ N142), L144 (≠ I143), R164 (= R163), P196 (= P195), T201 (= T200), V222 (≠ L221), A223 (≠ G222), R224 (= R223), H272 (= H271), S274 (≠ A273)
5vg6B Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with NADPH and mes.
31% identity, 90% coverage: 33:308/308 of query aligns to 43:315/315 of 5vg6B
- active site: M98 (= M95), R230 (= R223), D254 (= D247), E259 (= E252), H278 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A74 (= A68), R92 (≠ G89), M102 (≠ L99), L147 (≠ T140), G148 (= G141), D149 (≠ N142), L150 (≠ I143), W168 (≠ I161), S169 (≠ N162), R170 (= R163), T171 (≠ G164), K173 (= K166), L201 (= L194), P202 (= P195), T207 (= T200), V228 (≠ L221), R230 (= R223), H278 (= H271), A280 (= A273), S281 (≠ A274), Y315 (= Y308)
3kboA 2.14 angstrom crystal structure of putative oxidoreductase (ycdw) from salmonella typhimurium in complex with NADP
32% identity, 71% coverage: 91:308/308 of query aligns to 95:312/312 of 3kboA
- active site: M95 (≠ F91), R227 (= R223), E256 (= E252), H275 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: M99 (= M95), G143 (= G139), A144 (≠ T140), G145 (= G141), V146 (≠ N142), L147 (≠ I143), W165 (≠ I161), S166 (≠ N162), R167 (= R163), S168 (≠ G164), K170 (= K166), L197 (≠ I193), P199 (= P195), L225 (= L221), A226 (≠ G222), R227 (= R223), D251 (= D247), H275 (= H271), A278 (= A274), Y312 (= Y308)
Sites not aligning to the query:
7jqhA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with phosphate and NADP+
33% identity, 71% coverage: 91:308/308 of query aligns to 96:313/313 of 7jqhA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: M100 (= M95), A145 (≠ T140), G146 (= G141), V147 (≠ N142), L148 (≠ I143), W166 (≠ I161), S167 (≠ N162), R168 (= R163), T169 (≠ G164), K171 (= K166), L199 (= L194), P200 (= P195), L226 (= L221), A227 (≠ G222), R228 (= R223), D252 (= D247), H276 (= H271), A279 (= A274), Y313 (= Y308)
Sites not aligning to the query:
7jqiA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with alpha-ketoglutarate and NADP+
33% identity, 71% coverage: 91:308/308 of query aligns to 95:312/312 of 7jqiA
- binding 2-oxoglutaric acid: R227 (= R223), H275 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: M99 (= M95), A144 (≠ T140), G145 (= G141), V146 (≠ N142), L147 (≠ I143), W165 (≠ I161), S166 (≠ N162), R167 (= R163), T168 (≠ G164), K170 (= K166), L198 (= L194), P199 (= P195), L225 (= L221), R227 (= R223), H275 (= H271), A278 (= A274), Y312 (= Y308)
Sites not aligning to the query:
6p35A 2.5 angstrom structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with 2-keto arginine and NADP
33% identity, 71% coverage: 91:308/308 of query aligns to 95:312/312 of 6p35A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: M99 (= M95), A144 (≠ T140), G145 (= G141), V146 (≠ N142), L147 (≠ I143), W165 (≠ I161), S166 (≠ N162), R167 (= R163), T168 (≠ G164), K170 (= K166), L198 (= L194), P199 (= P195), L225 (= L221), R227 (= R223), H275 (= H271), A277 (= A273), A278 (= A274), Y312 (= Y308)
- binding 5-[(diaminomethylidene)amino]-2-oxopentanoic acid: R227 (= R223), H275 (= H271), T280 (≠ S276)
Sites not aligning to the query:
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
32% identity, 75% coverage: 67:296/308 of query aligns to 78:315/334 of 5aovA
- active site: L100 (≠ F91), R241 (= R223), D265 (= D247), E270 (= E252), H288 (= H271)
- binding glyoxylic acid: R241 (= R223), H288 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T104 (≠ M95), F158 (≠ T140), G159 (= G141), R160 (≠ N142), I161 (= I143), S180 (≠ N162), R181 (= R163), A211 (≠ I193), V212 (≠ L194), P213 (= P195), T218 (= T200), I239 (≠ L221), A240 (≠ G222), R241 (= R223), H288 (= H271), G290 (≠ A273)
Sites not aligning to the query:
4z0pA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
29% identity, 87% coverage: 40:308/308 of query aligns to 47:316/316 of 4z0pA
- active site: L95 (≠ F91), R231 (= R223), G250 (≠ Q242), D255 (= D247), E260 (= E252), H279 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (≠ T85), M99 (= M95), M144 (≠ T140), G145 (= G141), V146 (≠ N142), L147 (≠ I143), W165 (≠ I161), S166 (≠ N162), R167 (= R163), S168 (≠ G164), R170 (≠ K166), L197 (= L194), P198 (= P195), A229 (≠ L221), G230 (= G222), R231 (= R223), H279 (= H271), A281 (= A273), A282 (= A274), Y316 (= Y308)
- binding oxalic acid: W50 (= W43), G70 (≠ Y67), A71 (= A68), G72 (= G69), H114 (= H110), R115 (≠ K111), R231 (= R223), H279 (= H271)
4weqA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADP and sulfate (see paper)
29% identity, 87% coverage: 40:308/308 of query aligns to 47:316/316 of 4weqA
- active site: L95 (≠ F91), R231 (= R223), G250 (≠ Q242), D255 (= D247), E260 (= E252), H279 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R89 (≠ T85), M99 (= M95), M144 (≠ T140), G145 (= G141), V146 (≠ N142), L147 (≠ I143), W165 (≠ I161), S166 (≠ N162), R167 (= R163), S168 (≠ G164), R170 (≠ K166), L197 (= L194), P198 (= P195), A229 (≠ L221), G230 (= G222), R231 (= R223), D255 (= D247), H279 (= H271), A281 (= A273), Y316 (= Y308)
4zqbB Crystal structure of NADP-dependent dehydrogenase from rhodobactersphaeroides in complex with NADP and sulfate
28% identity, 80% coverage: 62:308/308 of query aligns to 69:316/316 of 4zqbB
- active site: L99 (= L84), R231 (= R223), E260 (= E252), H279 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R93 (= R79), M103 (≠ R88), G147 (= G139), L148 (≠ T140), G149 (= G141), E150 (≠ N142), L151 (≠ I143), W169 (≠ I161), S170 (≠ N162), R171 (= R163), S172 (≠ G164), K174 (= K166), L202 (= L194), P203 (= P195), F229 (≠ L221), R231 (= R223), H279 (= H271), S281 (≠ A273), A282 (= A274), Y316 (= Y308)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
34% identity, 60% coverage: 122:305/308 of query aligns to 137:323/332 of 6biiA
- active site: R240 (= R223), D264 (= D247), E269 (= E252), H287 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G156 (= G139), F157 (≠ T140), G158 (= G141), R159 (≠ N142), I160 (= I143), A179 (≠ N162), R180 (= R163), S181 (≠ G164), K183 (= K166), V211 (≠ L194), P212 (= P195), E216 (≠ Q199), T217 (= T200), V238 (≠ L221), A239 (≠ G222), R240 (= R223), D264 (= D247), H287 (= H271), G289 (≠ A273)
Sites not aligning to the query:
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
25% identity, 81% coverage: 51:298/308 of query aligns to 57:306/311 of 3bazA
- active site: L98 (≠ F91), R230 (= R223), A251 (= A244), D254 (= D247), E259 (= E252), H277 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (≠ A68), G149 (= G139), L150 (≠ T140), G151 (= G141), R152 (≠ N142), I153 (= I143), S172 (≠ N162), R173 (= R163), S174 (≠ G164), C201 (≠ L194), P202 (= P195), T207 (= T200), I228 (≠ L221), G229 (= G222), R230 (= R223), D254 (= D247), H277 (= H271), G279 (≠ A273)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
25% identity, 81% coverage: 51:298/308 of query aligns to 59:308/313 of Q65CJ7
5bqfA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADP, hepes and l(+)-tartaric acid
28% identity, 84% coverage: 51:308/308 of query aligns to 55:317/317 of 5bqfA
- active site: E261 (= E252), H280 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A72 (= A68), R90 (= R79), M100 (= M95), G144 (= G139), L145 (≠ T140), G146 (= G141), I147 (≠ N142), L148 (≠ I143), W166 (≠ I161), S167 (≠ N162), R168 (= R163), T169 (≠ G164), L198 (= L194), P199 (= P195), A230 (≠ L221), G231 (= G222), R232 (= R223), H280 (= H271), A283 (= A274), Y317 (= Y308)
4xcvA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH
28% identity, 84% coverage: 51:308/308 of query aligns to 55:317/317 of 4xcvA
- active site: E261 (= E252), H280 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A72 (= A68), R90 (= R79), M100 (= M95), G144 (= G139), L145 (≠ T140), G146 (= G141), I147 (≠ N142), L148 (≠ I143), W166 (≠ I161), S167 (≠ N162), R168 (= R163), T169 (≠ G164), K171 (= K166), L198 (= L194), P199 (= P195), A230 (≠ L221), G231 (= G222), R232 (= R223), H280 (= H271), A283 (= A274), Y317 (= Y308)
5tsdA Crystal structure of NADPH-dependent 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH and oxalate
28% identity, 84% coverage: 51:308/308 of query aligns to 54:316/316 of 5tsdA
- active site: E260 (= E252), H279 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A71 (= A68), R89 (= R79), M99 (= M95), G143 (= G139), L144 (≠ T140), G145 (= G141), I146 (≠ N142), L147 (≠ I143), W165 (≠ I161), S166 (≠ N162), R167 (= R163), T168 (≠ G164), K170 (= K166), L197 (= L194), P198 (= P195), A229 (≠ L221), G230 (= G222), R231 (= R223), D255 (= D247), H279 (= H271), Y316 (= Y308)
- binding oxalic acid: G70 (≠ Y67), A71 (= A68), G72 (= G69), R231 (= R223), H279 (= H271)
Sites not aligning to the query:
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
30% identity, 55% coverage: 137:304/308 of query aligns to 158:328/328 of Q9UBQ7
Sites not aligning to the query:
Query Sequence
>5208037 FitnessBrowser__PV4:5208037
MEHKLLLLTSDNDRYRSLLGSCHLPHLTLLGDDPQSILDADIWLAEPPLAAPLVGHAKQI
KWMQSTYAGVDLLVKPRLRRDYQLTNVRGIFGPLMSEYLFGYLLAHQRQHKQYQSQQAEK
IWRPGNFRTLQGQELLLLGTGNIAKHLAQTAKHFGMRVTGINRGAKPTIGFDSVDTLANL
AHHIDKADAIAAILPSTPQTQGALNQELLAMMKPEAILFNLGRGDVLDLDALYAQLLSHP
QQNAILDVFNQEPLPQEHPIWSLENVIITPHIAAPSFPEQVVEIFANNYHKFIKGEPLSH
KVNFERGY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory