Comparing 5208200 FitnessBrowser__PV4:5208200 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
41% identity, 77% coverage: 36:286/324 of query aligns to 12:265/265 of P07821
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
33% identity, 70% coverage: 36:263/324 of query aligns to 2:231/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 73% coverage: 34:271/324 of query aligns to 1:239/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
32% identity, 73% coverage: 36:271/324 of query aligns to 4:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
32% identity, 73% coverage: 36:271/324 of query aligns to 4:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
32% identity, 73% coverage: 36:271/324 of query aligns to 4:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
32% identity, 73% coverage: 36:271/324 of query aligns to 4:241/242 of 2oljA
5x40A Structure of a cbio dimer bound with amppcp (see paper)
37% identity, 66% coverage: 51:264/324 of query aligns to 21:237/280 of 5x40A
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 65% coverage: 46:257/324 of query aligns to 14:230/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
33% identity, 65% coverage: 46:257/324 of query aligns to 15:231/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
33% identity, 65% coverage: 46:257/324 of query aligns to 15:231/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
33% identity, 65% coverage: 46:257/324 of query aligns to 15:231/344 of 6cvlD
Sites not aligning to the query:
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
31% identity, 75% coverage: 35:277/324 of query aligns to 3:250/262 of 7chaI
2pmkA Crystal structures of an isolated abc-atpase in complex with tnp-adp (see paper)
31% identity, 69% coverage: 36:260/324 of query aligns to 4:231/243 of 2pmkA
2ff7A The abc-atpase of the abc-transporter hlyb in the adp bound state (see paper)
31% identity, 69% coverage: 36:260/324 of query aligns to 4:231/243 of 2ff7A
3b5jA Crystal structures of the s504a mutant of an isolated abc-atpase in complex with tnp-adp (see paper)
31% identity, 69% coverage: 36:260/324 of query aligns to 4:231/243 of 3b5jA
Q9LVM1 ABC transporter B family member 25, mitochondrial; ABC transporter ABCB.25; AtABCB25; ABC transporter of the mitochondrion 3; AtATM3; Iron-sulfur clusters transporter ATM3; Protein STARIK 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 66% coverage: 47:259/324 of query aligns to 491:704/728 of Q9LVM1
7n59A Structure of atatm3 in the inward-facing conformation with gssg bound (see paper)
34% identity, 66% coverage: 47:259/324 of query aligns to 365:578/590 of 7n59A
Sites not aligning to the query:
7n5aA Structure of atatm3 in the closed conformation (see paper)
34% identity, 66% coverage: 47:259/324 of query aligns to 364:577/589 of 7n5aA
Sites not aligning to the query:
7sgrE Structure of hemolysin a secretion system hlyb/d complex (see paper)
30% identity, 77% coverage: 12:260/324 of query aligns to 434:689/700 of 7sgrE
Sites not aligning to the query:
>5208200 FitnessBrowser__PV4:5208200
MSAPNQPSQTESLLSLGASEGSNLSAGDGACARPALSVRDLSWRCGERAILSGVKLDLPE
GKMLGIIGPNGAGKSSLLRCLYRFLTPSSGEIQLFGQPIASLSARAFAREVAVVLQDTPQ
HFDMTTAQLVALGLTPHKAAFSMTTKADRLAVSQALETVGLKERAGQTYASLSGGEKQRA
LIARAIAQQPKLLILDEPTNHLDIRYQIQILELLKALGVTVVISIHDLNLASALCDQLLL
LDQGKAVAQGSPKQVLSEAQIARVFCVCCQVSPHPQHGNPQINYFYGYHLHNADQSAQHG
SSSGSANGLADQPFEAKEANHDER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory