Comparing 5208391 FitnessBrowser__PV4:5208391 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vi7C Structure of a putative acetyltransferase (pa1377)from pseudomonas aeruginosa (see paper)
42% identity, 94% coverage: 11:172/173 of query aligns to 1:163/165 of 2vi7C
2ge3A Crystal structure of probable acetyltransferase from agrobacterium tumefaciens
32% identity, 80% coverage: 33:170/173 of query aligns to 17:160/164 of 2ge3A
2i79A The crystal structure of the acetyltransferase of gnat family from streptococcus pneumoniae
32% identity, 66% coverage: 59:173/173 of query aligns to 56:171/171 of 2i79A
Sites not aligning to the query:
3ld2B The crystal structure of smu.2055 from streptococcus mutans ua159
32% identity, 62% coverage: 61:168/173 of query aligns to 47:153/162 of 3ld2B
Sites not aligning to the query:
4jwpA Crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis in complex with acetyl coa
28% identity, 91% coverage: 16:173/173 of query aligns to 6:165/165 of 4jwpA
4pv6G Crystal structure analysis of ard1 from thermoplasma volcanium (see paper)
31% identity, 92% coverage: 15:173/173 of query aligns to 7:149/154 of 4pv6G
4pv6A Crystal structure analysis of ard1 from thermoplasma volcanium (see paper)
31% identity, 92% coverage: 15:173/173 of query aligns to 7:149/154 of 4pv6A
6e1xA Crystal structure of product-bound complex of spermidine/spermine n- acetyltransferase speg
25% identity, 87% coverage: 13:163/173 of query aligns to 3:154/170 of 6e1xA
4r87A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with coa and spermine (see paper)
25% identity, 87% coverage: 13:163/173 of query aligns to 3:154/170 of 4r87A
4r57A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with acetyl-coa (see paper)
25% identity, 87% coverage: 13:163/173 of query aligns to 3:154/170 of 4r57A
4nczA Spermidine n-acetyltransferase from vibrio cholerae in complex with 2- [n-cyclohexylamino]ethane sulfonate. (see paper)
25% identity, 87% coverage: 13:163/173 of query aligns to 3:154/170 of 4nczA
4mi4A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermine (see paper)
25% identity, 87% coverage: 13:163/173 of query aligns to 3:154/170 of 4mi4A
4mhdA Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermidine (see paper)
25% identity, 87% coverage: 13:163/173 of query aligns to 3:154/170 of 4mhdA
5cnpB X-ray crystal structure of spermidine n1-acetyltransferase from vibrio cholerae. (see paper)
25% identity, 87% coverage: 13:163/173 of query aligns to 3:154/171 of 5cnpB
6cx8A Crystal structure of spermidine/spermine n-acetyltransferase speg from vibrio cholerae in complex with manganese ions.
25% identity, 87% coverage: 13:163/173 of query aligns to 4:155/173 of 6cx8A
Q9KL03 Spermidine N(1)-acetyltransferase; SAT; Spermidine/spermine N(1)-acetyltransferase; SSAT; EC 2.3.1.57 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see 2 papers)
25% identity, 87% coverage: 13:163/173 of query aligns to 4:155/173 of Q9KL03
6e1xC Crystal structure of product-bound complex of spermidine/spermine n- acetyltransferase speg
25% identity, 87% coverage: 13:163/173 of query aligns to 7:158/176 of 6e1xC
6vfnA Crystal structure of speg allosteric polyamine acetyltransferase from bacillus thuringiensis in complex with spermine (see paper)
25% identity, 91% coverage: 13:169/173 of query aligns to 1:157/167 of 6vfnA
P0A951 Spermidine N(1)-acetyltransferase; SAT; Spermidine/spermine N(1)-acetyltransferase; SSAT; EC 2.3.1.57 from Escherichia coli (strain K12) (see 4 papers)
23% identity, 93% coverage: 9:169/173 of query aligns to 2:162/186 of P0A951
Sites not aligning to the query:
4jxrB Crystal structure of a gnat superfamily phosphinothricin acetyltransferase (pat) from sinorhizobium meliloti in complex with accoa
27% identity, 91% coverage: 15:171/173 of query aligns to 4:163/185 of 4jxrB
>5208391 FitnessBrowser__PV4:5208391
MAEHQFDSPQAPEISIRHSTDGDIEGIFALYGQRSCYAGTLQRPYPSLTFWQKRLKDLPE
NCYSLVAVREGKIVGQLGMEVYSNARRKHVANFGMAVCESARGQGIGSALLGAMIDLATN
WLAVRRIELEVYTDNEAAVALYKSHGFEIEGEAKDYAFRDGRYVNAFLMARCC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory