SitesBLAST
Comparing 5208465 FitnessBrowser__PV4:5208465 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
22% identity, 83% coverage: 31:387/428 of query aligns to 3:347/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I35), G8 (= G36), G10 (= G38), V11 (≠ Y39), I12 (≠ T40), V30 (≠ L58), E31 (= E59), K32 (≠ A60), E38 (≠ G66), A39 (= A67), S40 (= S68), A43 (≠ N71), G45 (= G73), L46 (≠ Q74), V171 (= V210), G200 (= G237), G201 (≠ N238), W203 (≠ Y240), G298 (= G340), R300 (≠ F342), P301 (≠ L343), Y326 (vs. gap), R327 (vs. gap), N328 (vs. gap), G329 (= G369), I330 (≠ V370)
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
23% identity, 81% coverage: 43:387/428 of query aligns to 18:349/369 of S5FMM4
- G51 (≠ V76) mutation to S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- A54 (≠ F79) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- K81 (≠ N117) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
- S202 (≠ G237) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ V370) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ L380) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
28% identity, 54% coverage: 12:244/428 of query aligns to 10:231/824 of Q8GAI3
- W66 (≠ G69) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (≠ R70) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
Query Sequence
>5208465 FitnessBrowser__PV4:5208465
MTCTPHANSYYAASANTKALRDKLSDNIETDVCIIGAGYTGLSSAIHLLEAGFKVTVLEA
ARVGFGASGRNGGQIVNSFSRDIDTIEKVVGTEQAKLFGQMAFEGGRILKGLVAKYNIQC
DLKDGGVFAALNKKQMGHLEAQKALWEKHGHLGHLELLDEQGIRDVVDTERYVGGLLDKS
GGHIHPLNLALGEADAVESLGGQIFEDSAVVRVDQGENPVVHTQEGSVKCKFVIVAGNAY
LKGLLPELQAKSMPCGTQVITTEPLGEELAHSLLPQDYCVEDCNYLLDYFRLSGDKRLIY
GGGVVYGARDPANIEAIIRPKMLATFPQLKDVKIDFTWTGNFLLTLSRLPQVGRIGGNIY
YSQGCSGHGVTYTHLAGQILAETINGQAKRFDAFAQLPHYPFPGGHLLQVPFSAIGAWYY
TMRDKLGV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory