SitesBLAST
Comparing 5208569 FitnessBrowser__PV4:5208569 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
P00547 Homoserine kinase; HK; HSK; EC 2.7.1.39 from Escherichia coli (strain K12) (see paper)
56% identity, 98% coverage: 3:311/316 of query aligns to 2:309/310 of P00547
- H139 (= H141) mutation to L: 35-fold decrease in kinase activity.
- H203 (≠ F205) mutation to L: 2-fold decrease in kinase activity but nearly no change in substrates affinity.
- H206 (≠ Y208) mutation to Q: 3500-fold decrease in kinase activity.
- R235 (= R237) mutation to H: 250-fold decrease in kinase activity but no change in substrates affinity.; mutation to L: 26200-fold decrease in catalytic efficiency.
Q8L7R2 Homoserine kinase; Protein DOWNY MILDEW RESISTANT 1; EC 2.7.1.39 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 99% coverage: 1:312/316 of query aligns to 52:367/370 of Q8L7R2
- G118 (≠ Y68) mutation to R: In dmr1-6; loss of function.
- G180 (≠ M129) mutation to D: In dmr1-5; loss of function.
- G202 (= G152) mutation to R: In dmr1-4; loss of function.
- M241 (= M189) mutation to K: In dmr1-3; loss of function.
- A267 (= A215) mutation to V: In dmr1-1; loss of function.
Sites not aligning to the query:
- 46 E→K: In dmr1-2; loss of function.
1h74B Crystal structure of homoserine kinase complexed with ile (see paper)
30% identity, 85% coverage: 1:270/316 of query aligns to 1:263/296 of 1h74B
- active site: E126 (= E133), T179 (= T186)
- binding phosphothiophosphoric acid-adenylate ester: N58 (= N65), V59 (≠ I66), K83 (= K90), A87 (≠ V94), G88 (= G95), G90 (= G97), G92 (= G99), S93 (= S100), S94 (= S101), S97 (= S104), S129 (≠ I136)
- binding isoleucine: A12 (≠ G12), N13 (= N13), D19 (= D19), H134 (= H141), D136 (= D143), N137 (= N144), R183 (= R190), R231 (= R237), G256 (= G263)
1h74A Crystal structure of homoserine kinase complexed with ile (see paper)
30% identity, 85% coverage: 1:270/316 of query aligns to 1:263/296 of 1h74A
- active site: E126 (= E133), T179 (= T186)
- binding adenosine-5'-diphosphate: I51 (≠ L58), N58 (= N65), V59 (≠ I66), K83 (= K90), A87 (≠ V94), G88 (= G95), S93 (= S100), S94 (= S101), S97 (= S104), T179 (= T186)
- binding isoleucine: N13 (= N13), F18 (= F18), D19 (= D19), H134 (= H141), T179 (= T186), R183 (= R190), R231 (= R237)
1h73A Crystal structure of homoserine kinase complexed with threonine (see paper)
30% identity, 85% coverage: 1:270/316 of query aligns to 1:263/296 of 1h73A
- active site: E126 (= E133), T179 (= T186)
- binding phosphoaminophosphonic acid-adenylate ester: I51 (≠ L58), N58 (= N65), V59 (≠ I66), K83 (= K90), A87 (≠ V94), G88 (= G95), G90 (= G97), L91 (= L98), G92 (= G99), S93 (= S100), S94 (= S101), S97 (= S104)
- binding threonine: N13 (= N13), D19 (= D19), R183 (= R190), R231 (= R237)
1h72C Crystal structure of homoserine kinase complexed with hse (see paper)
30% identity, 85% coverage: 1:270/316 of query aligns to 1:263/296 of 1h72C
- active site: E126 (= E133), T179 (= T186)
- binding phosphoaminophosphonic acid-adenylate ester: I51 (≠ L58), N58 (= N65), V59 (≠ I66), K83 (= K90), A87 (≠ V94), G88 (= G95), G90 (= G97), L91 (= L98), G92 (= G99), S93 (= S100), S94 (= S101), S97 (= S104), S129 (≠ I136), T179 (= T186), S257 (= S264)
- binding l-homoserine: N13 (= N13), F18 (= F18), D19 (= D19), D136 (= D143), N137 (= N144), R183 (= R190), R231 (= R237)
1fwkA Crystal structure of homoserine kinase complexed with adp (see paper)
30% identity, 85% coverage: 1:270/316 of query aligns to 1:263/296 of 1fwkA
6cyzA Mycobacterial homoserine kinase thrb in complex with amppnp
29% identity, 86% coverage: 1:272/316 of query aligns to 8:264/295 of 6cyzA
2v8pA Ispe in complex with adp and cdp (see paper)
23% identity, 71% coverage: 62:284/316 of query aligns to 59:263/270 of 2v8pA
Sites not aligning to the query:
2v34B Ispe in complex with cytidine and ligand (see paper)
23% identity, 71% coverage: 62:284/316 of query aligns to 59:263/270 of 2v34B
- active site: D132 (= D143)
- binding 4-amino-1-beta-d-ribofuranosyl-2(1h)-pyrimidinone: K147 (≠ P160), Y177 (≠ R190)
- binding [(1e,3r,4s)-4-fluoro-3,5-dihydroxy-4-methylpent-1-en-1-yl]phosphonic acid: P91 (≠ V94), G92 (= G95), G94 (= G97), L95 (= L98), G96 (= G99), G97 (≠ S100), G98 (≠ S101), T173 (= T186)
Sites not aligning to the query:
2v2vA Ispe in complex with ligand (see paper)
23% identity, 71% coverage: 62:284/316 of query aligns to 59:263/270 of 2v2vA
- active site: D132 (= D143)
- binding glycerol: N62 (= N65), L63 (≠ I66), K87 (= K90), G98 (≠ S101)
- binding sulfate ion: G92 (= G95), G94 (= G97), G96 (= G99), R215 (≠ A233), R226 (≠ A249)
- binding 5'-[(1h-benzimidazol-2-ylacetyl)amino]-5'-deoxycytidine: K147 (≠ P160), S172 (= S185), T173 (= T186), Y177 (≠ R190)
Sites not aligning to the query:
2v2qB Ispe in complex with ligand (see paper)
23% identity, 71% coverage: 62:284/316 of query aligns to 59:263/270 of 2v2qB
- active site: D132 (= D143)
- binding glycerol: N62 (= N65), L63 (≠ I66), K87 (= K90), G98 (≠ S101), N101 (≠ S104)
- binding 4-amino-1-(5-{[3-(1h-benzimidazol-2-yl)propanoyl]amino}-5-deoxy-alpha-l-lyxofuranosyl)pyrimidin-2(1h)-one: I129 (≠ V140), S130 (≠ H141), A131 (≠ Y142), K147 (≠ P160), T173 (= T186), Y177 (≠ R190)
- binding sulfate ion: P91 (≠ V94), G94 (= G97), G98 (≠ S101), T173 (= T186), R215 (≠ A233), R226 (≠ A249), G239 (= G263), S240 (= S264)
Sites not aligning to the query:
2vf3A Aquifex aeolicus ispe in complex with ligand (see paper)
23% identity, 71% coverage: 62:284/316 of query aligns to 58:262/269 of 2vf3A
Sites not aligning to the query:
2v34A Ispe in complex with cytidine and ligand (see paper)
23% identity, 71% coverage: 62:284/316 of query aligns to 58:262/269 of 2v34A
Sites not aligning to the query:
2v2zA Ispe in complex with adp and cdpme (see paper)
23% identity, 71% coverage: 62:284/316 of query aligns to 58:262/269 of 2v2zA
- active site: D131 (= D143)
- binding adenosine-5'-diphosphate: N61 (= N65), L62 (≠ I66), K86 (= K90), P90 (≠ V94), G91 (= G95), G93 (= G97), G95 (= G99), G97 (≠ S101), N100 (≠ S104)
- binding 4-diphosphocytidyl-2-c-methyl-d-erythritol: S129 (≠ H141), A130 (≠ Y142), D131 (= D143), K146 (≠ P160), T172 (= T186), Y176 (≠ R190), G238 (= G263)
Sites not aligning to the query:
Query Sequence
>5208569 FitnessBrowser__PV4:5208569
MSLTVYAPASMGNVGVGFDLLGAALAPVDGCLLGDRVAIESAPHGVSLSLAGHWADKLPA
ASEENIVYQCATFFLEQLGSRAGVAMTLEKNLPVGSGLGSSASSVVAALYALNEHFDRPY
DSDALLRLMGEFEGKISGSVHYDNVAPCYLGGMQLMLDTPSAVCQGLPVFKDWYWVVAYP
GISLSTAKMRALLPAQYDKSVAIDFGRYLSAFVHASYRQDAKLAIEVLKDVLAEPYRASE
IPGYEQARAALDELGMATTGISGSGPTLFSVTDNLETANKAKAWLDANYVTSGSGFSHIC
QIDMLGTRRVDAAILD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory