Comparing 5208938 FitnessBrowser__PV4:5208938 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2v6kA Structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione (see paper)
48% identity, 100% coverage: 1:214/214 of query aligns to 3:214/214 of 2v6kA
2jl4A Holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class (see paper)
48% identity, 100% coverage: 1:214/214 of query aligns to 1:212/212 of 2jl4A
O86043 Maleylpyruvate isomerase; MPI; Naphthalene degradation protein L; EC 5.2.1.4 from Ralstonia sp. (see paper)
48% identity, 100% coverage: 1:214/214 of query aligns to 1:212/212 of O86043
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
48% identity, 99% coverage: 3:213/214 of query aligns to 4:206/208 of 1fw1A
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
46% identity, 99% coverage: 3:213/214 of query aligns to 8:210/216 of Q9WVL0
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
46% identity, 99% coverage: 3:213/214 of query aligns to 5:207/212 of 2cz2A
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
47% identity, 99% coverage: 3:213/214 of query aligns to 8:210/216 of O43708
4pxoA Crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068)
40% identity, 100% coverage: 1:213/214 of query aligns to 3:214/216 of 4pxoA
D2YW48 Probable glutathione S-transferase; EC 2.5.1.18 from Coccidioides immitis (strain RS) (Valley fever fungus)
39% identity, 100% coverage: 1:213/214 of query aligns to 6:225/231 of D2YW48
3n5oA Crystal structure of putative glutathione transferase from coccidioides immitis bound to glutathione (see paper)
39% identity, 100% coverage: 1:213/214 of query aligns to 4:223/228 of 3n5oA
4kdyA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound gsh in the active site
38% identity, 100% coverage: 1:213/214 of query aligns to 10:214/222 of 4kdyA
4kaeA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound dicarboxyethyl glutathione and citrate in the active site
38% identity, 100% coverage: 1:213/214 of query aligns to 8:212/220 of 4kaeA
3wywB Structural characterization of catalytic site of a nilaparvata lugens delta-class glutathione transferase (see paper)
36% identity, 84% coverage: 11:189/214 of query aligns to 20:181/214 of 3wywB
Sites not aligning to the query:
5zwpA Crystal structure of the delta-class glutathione transferase from musca domestica (see paper)
29% identity, 89% coverage: 6:195/214 of query aligns to 4:185/207 of 5zwpA
P20432 Glutathione S-transferase D1; DDT-dehydrochlorinase; EC 2.5.1.18; EC 4.5.1.1 from Drosophila melanogaster (Fruit fly) (see paper)
29% identity, 86% coverage: 17:199/214 of query aligns to 16:190/209 of P20432
Sites not aligning to the query:
3makA Crystal structure of glutathione transferase dmgstd1 from drosophila melanogaster, in complex with glutathione (see paper)
29% identity, 86% coverage: 17:199/214 of query aligns to 15:189/208 of 3makA
Sites not aligning to the query:
7rhpA Crystal structure of honeybee (apis mellifera) glutathione s- transferase amgstd1 (see paper)
31% identity, 82% coverage: 17:191/214 of query aligns to 22:188/215 of 7rhpA
7dazA Crystal structure of drosophila melanogaster noppera-bo, glutathione s-transferase epsilon 14 (dmgste14), in tdp015- and gsh-bound form
29% identity, 91% coverage: 8:202/214 of query aligns to 10:195/219 of 7dazA
Sites not aligning to the query:
7db4A Crystal structure of drosophila melanogaster noppera-bo, glutathione s-transferase epsilon 14 (dmgste14), in tdp012- and glutathione-bound form
29% identity, 91% coverage: 8:202/214 of query aligns to 10:195/225 of 7db4A
Sites not aligning to the query:
6keoAA Glutathione S-transferase E14 (see paper)
29% identity, 91% coverage: 8:202/214 of query aligns to 10:195/225 of 6keoAA
Sites not aligning to the query:
>5208938 FitnessBrowser__PV4:5208938
MKLLGYWRSSAAYRVRIALNLKGLDAELESVHLVKNGGEQHLPEYAALNPQELVPTLIEG
DNEFVLSQSLAIIEYLDEQYGGAMMLPTAPKARAEVRAMALSIACEVHPLNNLKVLQYLT
NTLELDEDAKNAWYHHWIHQGFSAFEKQLEKHAGSYCYGDEVTLADLCLIPQVYNANRFK
VDLSTYPNIRRIWDNCHQLEAFVLAAPERQADAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory