SitesBLAST
Comparing 5209856 FitnessBrowser__PV4:5209856 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5dt9A Crystal structure of a putative d-erythronate-4-phosphate dehydrogenase from vibrio cholerae
50% identity, 99% coverage: 1:372/376 of query aligns to 4:375/379 of 5dt9A
- active site: N95 (= N92), R212 (= R209), D236 (= D233), E241 (= E238), H258 (= H255)
- binding nicotinamide-adenine-dinucleotide: N95 (= N92), G129 (= G126), Q130 (≠ N127), V131 (≠ T128), D150 (= D147), K153 (≠ L150), H178 (= H175), T179 (≠ V176), P180 (= P177), W187 (≠ H184), T189 (= T186), A210 (≠ C207), A211 (≠ C208), H258 (= H255), A260 (= A257), G261 (= G258)
3oetH D-erythronate-4-phosphate dehydrogenase complexed with NAD
46% identity, 99% coverage: 1:374/376 of query aligns to 3:375/378 of 3oetH
- active site: N93 (= N92), R210 (= R209), D234 (= D233), E237 (= E236), E239 (= E238), G253 (≠ A252), H256 (= H255)
- binding nicotinamide-adenine-dinucleotide: N93 (= N92), V97 (= V96), G125 (= G124), G127 (= G126), N128 (= N127), V129 (≠ T128), D148 (= D147), P149 (= P148), P150 (≠ L149), H176 (= H175), T177 (≠ V176), P178 (= P177), Y185 (≠ H184), T187 (= T186), A208 (≠ C207), C209 (= C208), H256 (= H255), A258 (= A257)
2o4cA Crystal structure of d-erythronate-4-phosphate dehydrogenase complexed with NAD (see paper)
47% identity, 95% coverage: 1:357/376 of query aligns to 1:362/380 of 2o4cA
- active site: N91 (= N92), R208 (= R209), D232 (= D233), E237 (= E238), H254 (= H255)
- binding nicotinamide-adenine-dinucleotide: N91 (= N92), V95 (= V96), G123 (= G124), G125 (= G126), Q126 (≠ N127), V127 (≠ T128), D146 (= D147), P147 (= P148), P148 (≠ L149), H174 (= H175), T175 (≠ V176), P176 (= P177), H183 (= H184), T185 (= T186), A206 (≠ C207), S207 (≠ C208), H254 (= H255), A256 (= A257), G257 (= G258)
- binding phosphate ion: T66 (= T67), R346 (= R341)
Q9I3W9 Erythronate-4-phosphate dehydrogenase; EC 1.1.1.290 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
47% identity, 95% coverage: 1:357/376 of query aligns to 1:362/380 of Q9I3W9
- C65 (≠ A66) modified: Disulfide link with 90
- C90 (= C91) modified: Disulfide link with 65
- QV 126:127 (≠ NT 127:128) binding
- D146 (= D147) binding
- T175 (≠ V176) binding
- ASR 206:208 (≠ CCR 207:209) binding
- D232 (= D233) binding
- G257 (= G258) binding
3kb6B Crystal structure of d-lactate dehydrogenase from aquifex aeolicus complexed with NAD and lactic acid (see paper)
28% identity, 68% coverage: 4:260/376 of query aligns to 8:299/334 of 3kb6B
- active site: S97 (≠ N92), R231 (= R209), D255 (= D233), E260 (= E238), H294 (= H255)
- binding lactic acid: F49 (≠ R44), S72 (≠ T67), V73 (≠ I68), G74 (= G69), Y96 (≠ C91), R231 (= R209), H294 (= H255)
- binding nicotinamide-adenine-dinucleotide: V73 (≠ I68), Y96 (≠ C91), V101 (= V96), G150 (= G126), R151 (≠ N127), I152 (≠ T128), D171 (= D147), V172 (≠ P148), P203 (= P177), T229 (≠ C207), A230 (≠ C208), R231 (= R209), H294 (= H255), A296 (= A257), Y297 (≠ G258)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
31% identity, 62% coverage: 35:267/376 of query aligns to 39:290/304 of 1wwkA
- active site: S96 (≠ N92), R230 (= R209), D254 (= D233), E259 (= E238), H278 (= H255)
- binding nicotinamide-adenine-dinucleotide: V100 (= V96), G146 (= G124), F147 (≠ A125), G148 (= G126), R149 (≠ N127), I150 (≠ T128), Y168 (≠ N146), D169 (= D147), P170 (= P148), V201 (= V176), P202 (= P177), T207 (= T186), T228 (≠ C207), S229 (≠ C208), D254 (= D233), H278 (= H255), G280 (≠ A257)
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
31% identity, 70% coverage: 3:266/376 of query aligns to 6:289/525 of 3ddnB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
31% identity, 70% coverage: 3:266/376 of query aligns to 5:288/526 of 3dc2A
Sites not aligning to the query:
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 55% coverage: 34:239/376 of query aligns to 94:314/466 of P87228
- S258 (≠ T179) modified: Phosphoserine
Sites not aligning to the query:
- 87 modified: Phosphoserine
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
27% identity, 65% coverage: 34:277/376 of query aligns to 42:310/334 of 5aovA
- active site: L100 (≠ N92), R241 (= R209), D265 (= D233), E270 (= E238), H288 (= H255)
- binding glyoxylic acid: M52 (≠ R44), L53 (≠ S45), L53 (≠ S45), Y74 (≠ A66), A75 (≠ T67), V76 (≠ I68), G77 (= G69), R241 (= R209), H288 (= H255)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ I68), T104 (≠ V96), F158 (≠ A125), G159 (= G126), R160 (≠ N127), I161 (≠ T128), S180 (≠ D147), R181 (≠ P148), A211 (≠ H175), V212 (= V176), P213 (= P177), T218 (= T186), I239 (≠ C207), A240 (≠ C208), R241 (= R209), H288 (= H255), G290 (≠ A257)
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
26% identity, 70% coverage: 3:266/376 of query aligns to 10:294/533 of O43175
- T78 (≠ I68) binding
- R135 (vs. gap) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ NT 127:128) binding
- D175 (= D147) binding
- T207 (≠ V176) binding
- CAR 234:236 (≠ CCR 207:209) binding
- D260 (= D233) binding
- V261 (= V234) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HIAG 255:258) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
29% identity, 62% coverage: 28:261/376 of query aligns to 35:293/332 of 6biiA
- active site: L99 (vs. gap), R240 (= R209), D264 (= D233), E269 (= E238), H287 (= H255)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ I68), T103 (vs. gap), G156 (= G124), F157 (≠ A125), G158 (= G126), R159 (≠ N127), I160 (≠ T128), A179 (≠ D147), R180 (≠ P148), S181 (≠ L149), K183 (≠ E151), V211 (= V176), P212 (= P177), E216 (≠ D181), T217 (= T186), V238 (≠ C207), A239 (≠ C208), R240 (= R209), D264 (= D233), H287 (= H255), G289 (≠ A257)
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
26% identity, 70% coverage: 3:266/376 of query aligns to 4:288/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N92), A100 (≠ V96), R149 (≠ N127), I150 (≠ T128), Y168 (≠ N146), D169 (= D147), P170 (= P148), I171 (≠ L149), H200 (= H175), T201 (≠ V176), P202 (= P177), T207 (= T186), C228 (= C207), A229 (≠ C208), R230 (= R209), H277 (= H255), G279 (≠ A257)
7dkmA Phgdh covalently linked to oridonin (see paper)
26% identity, 70% coverage: 3:266/376 of query aligns to 6:290/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ I68), A102 (≠ V96), G148 (= G124), R151 (≠ N127), I152 (≠ T128), Y170 (≠ N146), D171 (= D147), P172 (= P148), I173 (≠ L149), H202 (= H175), T203 (≠ V176), P204 (= P177), T209 (= T186), C230 (= C207), A231 (≠ C208), R232 (= R209), H279 (= H255), G281 (≠ A257)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: C14 (≠ Y11), K17 (≠ A14), I18 (≠ L15)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 293
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
26% identity, 70% coverage: 3:266/376 of query aligns to 4:288/297 of 6rj3A
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
26% identity, 70% coverage: 3:266/376 of query aligns to 5:289/301 of 6rj5A
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
26% identity, 70% coverage: 3:266/376 of query aligns to 5:289/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V123), G147 (= G124), L148 (≠ A125), G149 (= G126), R150 (≠ N127), I151 (≠ T128), G152 (= G129), D170 (= D147), H201 (= H175), T202 (≠ V176), P203 (= P177)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
26% identity, 70% coverage: 3:266/376 of query aligns to 5:289/302 of 6rihA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
26% identity, 70% coverage: 3:266/376 of query aligns to 5:289/303 of 6plgA
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
26% identity, 70% coverage: 3:266/376 of query aligns to 6:290/305 of 6plfA
Query Sequence
>5209856 FitnessBrowser__PV4:5209856
MKIVADENMPYVEALFADLGEVVMVDGRTLTQAQVKDADVLLVRSVTKVNKSLLDGCDRL
SFVGSATIGMDHLDLDYLKQRGIFCTNAPGCNAVAVGEYAFNAMLELARRFHNPLKGKTV
GIVGAGNTGTALQKCLEAYGVKTLLNDPLLEQSGDEREFVSLDELIERCDVISLHVPLTR
DGEHPTHYLFDKRRLNALAEDTWLLNCCRGEVIDNRALIEVKQQRSDLKLVLDVWEGEPL
PMPELVPLVEVATPHIAGYSLEGKARGTFMLYQALMAQLGRAVDKSLASLLPPLWSHQLS
PLSVPDEKALLCLVRLVYDLRDDDELFRQRFQNNKGFDLMRKNHKHRREFSALMLANTAG
SDVDWLLELGFSGVGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory