Comparing 5210055 FitnessBrowser__PV4:5210055 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 95% coverage: 5:252/261 of query aligns to 1:242/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
35% identity, 95% coverage: 5:252/261 of query aligns to 2:243/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
35% identity, 95% coverage: 5:252/261 of query aligns to 2:243/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
35% identity, 95% coverage: 5:252/261 of query aligns to 2:243/344 of 6cvlD
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
33% identity, 95% coverage: 4:251/261 of query aligns to 2:244/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
33% identity, 95% coverage: 4:251/261 of query aligns to 2:244/253 of 7z15I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
33% identity, 95% coverage: 4:251/261 of query aligns to 2:244/250 of 7z16I
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 95% coverage: 4:252/261 of query aligns to 1:237/241 of 4u00A
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
31% identity, 95% coverage: 4:252/261 of query aligns to 2:260/330 of P0AAH4
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
33% identity, 90% coverage: 19:253/261 of query aligns to 8:238/240 of 4ymuJ
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
34% identity, 84% coverage: 34:253/261 of query aligns to 46:265/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
34% identity, 84% coverage: 34:253/261 of query aligns to 46:265/382 of 7aheC
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
33% identity, 86% coverage: 30:253/261 of query aligns to 19:240/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
33% identity, 86% coverage: 30:253/261 of query aligns to 19:240/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
33% identity, 86% coverage: 30:253/261 of query aligns to 19:240/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
33% identity, 86% coverage: 30:253/261 of query aligns to 19:240/242 of 2oljA
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
34% identity, 82% coverage: 34:248/261 of query aligns to 46:260/260 of 7ahdC
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 98% coverage: 3:258/261 of query aligns to 15:255/378 of P69874
Sites not aligning to the query:
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
30% identity, 85% coverage: 19:240/261 of query aligns to 9:226/276 of Q5M243
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
33% identity, 85% coverage: 29:251/261 of query aligns to 22:254/310 of 4fwiB
Sites not aligning to the query:
>5210055 FitnessBrowser__PV4:5210055
MKSPLLKVNRLSKTFFAGYKGFKRQYNHALEPISFELNRGETLAIVGETGSGKSTLARIL
VGAEQRTDGEILFEGEALESRNLKQRCRLIRMIFQDPNTSLNPRLTVGELLDEPLRFNTD
LDKQARFAQVVDTLRKVGLLPEHADFYPHMISEGMKQRVAVARALMLNPKIIIADEALTA
LDLSVRSQILNLLLKLQQEMGLSYIFVSHNMNIIRHFSDKIMVLHQGKMVEKATTEKLFN
APEHEYTQRLIQEQTMFSYKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory