Comparing 5210088 FitnessBrowser__PV4:5210088 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
7d53A Spua mutant - h221n with glu (see paper)
42% identity, 89% coverage: 14:251/267 of query aligns to 4:242/249 of 7d53A
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
42% identity, 89% coverage: 14:251/267 of query aligns to 10:248/255 of 7d50B
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
38% identity, 92% coverage: 12:256/267 of query aligns to 6:249/254 of P76038
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
38% identity, 92% coverage: 12:256/267 of query aligns to 4:247/252 of 6vtvB
7d4rB Spua native structure (see paper)
38% identity, 89% coverage: 14:251/267 of query aligns to 2:210/215 of 7d4rB
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 88% coverage: 29:264/267 of query aligns to 85:308/308 of O33341
3fijA Crystal structure of a uncharacterized protein lin1909
36% identity, 88% coverage: 13:247/267 of query aligns to 2:216/224 of 3fijA
3uowA Crystal structure of pf10_0123, a gmp synthetase from plasmodium falciparum
25% identity, 73% coverage: 36:231/267 of query aligns to 12:200/517 of 3uowA
Sites not aligning to the query:
1vcnA Crystal structure of t.Th. Hb8 ctp synthetase complex with sulfate anion (see paper)
32% identity, 47% coverage: 111:235/267 of query aligns to 353:487/506 of 1vcnA
Sites not aligning to the query:
1vcoA Crystal structure of t.Th. Hb8 ctp synthetase complex with glutamine (see paper)
30% identity, 47% coverage: 111:235/267 of query aligns to 366:511/531 of 1vcoA
Sites not aligning to the query:
7miuC Mouse ctps2 bound to inhibitor r80 (see paper)
26% identity, 49% coverage: 105:234/267 of query aligns to 375:516/542 of 7miuC
Sites not aligning to the query:
>5210088 FitnessBrowser__PV4:5210088
MPITQTTSAKKSKPIILMTMGQQDRNQHPYQVMTHKYMQPIVEIAGAIPLLMPTCFGIED
VDRYLDMVDGVYLSGAGSNIDPSLYGQENLTPEKSQDVNRDTVDLAIIAGALKRKLPILG
ICRGMQELNIALGGTLYQKVYSEPGFDDHREDPQTPNHVQYGPRHPIKTVPGSWLAKLIG
DKTMVNSLHGQGICTLGKGLEALAYGEDGLIEAIHGPDYGQFILGVQWHPEWQANDNPDS
IKLFQAFGSACRGEVSWQSANDAKLTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory