SitesBLAST
Comparing 5210113 FitnessBrowser__PV4:5210113 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P97852 Peroxisomal multifunctional enzyme type 2; MFE-2; 17-beta-hydroxysteroid dehydrogenase 4; 17-beta-HSD 4; D-bifunctional protein; DBP; Multifunctional protein 2; MFP-2; EC 1.1.1.n12; EC 4.2.1.107; EC 4.2.1.119 from Rattus norvegicus (Rat) (see paper)
40% identity, 74% coverage: 2:227/306 of query aligns to 5:226/735 of P97852
- 16:40 (vs. 13:37, 68% identical) binding
1gz6A (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 (see paper)
41% identity, 74% coverage: 2:227/306 of query aligns to 3:224/301 of 1gz6A
- active site: S149 (≠ G152), Y162 (= Y165), K166 (= K169)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), L19 (= L18), D38 (= D37), L39 (≠ S38), S73 (≠ D73), V74 (= V74), N97 (= N100), A98 (= A101), G99 (= G102), I100 (= I103), H121 (≠ D124), T147 (= T150), S149 (≠ G152), Y162 (= Y165), K166 (= K169), P192 (= P195), A194 (= A197), S196 (≠ T199), R197 (≠ A200), M198 (= M201)
1zbqA Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type 4 in complex with NAD
41% identity, 74% coverage: 2:227/306 of query aligns to 3:224/302 of 1zbqA
- active site: S149 (≠ G152), Y162 (= Y165), K166 (= K169)
- binding nicotinamide-adenine-dinucleotide: G14 (= G13), G18 (= G17), L19 (= L18), D38 (= D37), L39 (≠ S38), S73 (≠ D73), V74 (= V74), N97 (= N100), A98 (= A101), T147 (= T150), S149 (≠ G152), Y162 (= Y165), K166 (= K169), P192 (= P195), N193 (≠ E196), A194 (= A197), S196 (≠ T199), R197 (≠ A200), M198 (= M201)
P51659 Peroxisomal multifunctional enzyme type 2; MFE-2; 17-beta-hydroxysteroid dehydrogenase 4; 17-beta-HSD 4; D-bifunctional protein; DBP; Multifunctional protein 2; MFP-2; Short chain dehydrogenase/reductase family 8C member 1; EC 1.1.1.n12; EC 4.2.1.107; EC 4.2.1.119 from Homo sapiens (Human) (see 5 papers)
41% identity, 74% coverage: 2:227/306 of query aligns to 5:226/736 of P51659
- G16 (= G13) to S: in DBPD; no dehydrogenase activity; dbSNP:rs137853096
- R106 (≠ V107) to H: in dbSNP:rs25640
Sites not aligning to the query:
- 347 Y→A: No hydratase activity.
- 366 E→A: No hydratase activity.
- 370 D→A: No effect.
- 406 H→A: No effect.
- 408 E→A: No effect.
- 410 Y→A: No effect.
- 457 N → Y: in DBPD; the mutation leads to an unstable protein; dbSNP:rs137853097
- 490 D→A: No effect.
- 505 Y→A: Completely inactive.
- 510 D→A: No hydratase activity.
- 511 W → R: in dbSNP:rs11539471
- 515 H→A: Completely inactive.
- 517 D→A: No effect.
- 532 H→A: No effect.
- 559 I → V: in dbSNP:rs11205
1gz6B (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 (see paper)
42% identity, 68% coverage: 2:210/306 of query aligns to 3:197/278 of 1gz6B
- active site: S141 (≠ G152), Y154 (= Y165), K158 (= K169)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), L19 (= L18), D38 (= D37), L39 (≠ S38), S65 (≠ D73), V66 (= V74), N89 (= N100), A90 (= A101), G91 (= G102), H113 (≠ D124), T139 (= T150), S141 (≠ G152), Y154 (= Y165), K158 (= K169), P184 (= P195)
P22414 Peroxisomal hydratase-dehydrogenase-epimerase; HDE; Multifunctional beta-oxidation protein; MFP; EC 4.2.1.119; EC 1.1.1.n12 from Candida tropicalis (Yeast) (see paper)
32% identity, 89% coverage: 4:274/306 of query aligns to 6:274/906 of P22414
Sites not aligning to the query:
- 699 binding
- 700 binding
- 729 binding
- 757 binding
- 808 binding
- 810 binding
- 831 binding
- 856 binding
- 857 binding
- 858 binding
P96825 Putative short-chain type dehydrogenase/reductase Rv0148; EC 1.1.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 75% coverage: 1:228/306 of query aligns to 1:227/286 of P96825
Sites not aligning to the query:
- 280 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
7x5jC Acp-dependent oxoacyl reductase
34% identity, 62% coverage: 4:194/306 of query aligns to 2:185/256 of 7x5jC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), S13 (≠ G15), G15 (= G17), L16 (= L18), N36 (≠ S38), R37 (≠ G39), N38 (≠ S40), D62 (= D73), V63 (= V74), N89 (= N100), A90 (= A101), A91 (vs. gap), V114 (= V123), I141 (≠ T150), Y156 (= Y165), K160 (= K169)
Sites not aligning to the query:
4nbuB Crystal structure of fabg from bacillus sp (see paper)
31% identity, 70% coverage: 1:213/306 of query aligns to 2:201/244 of 4nbuB
- active site: G18 (= G17), N111 (≠ D124), S139 (≠ G152), Q149 (≠ E162), Y152 (= Y165), K156 (= K169)
- binding acetoacetyl-coenzyme a: D93 (≠ P106), K98 (≠ S111), S139 (≠ G152), N146 (≠ D159), V147 (≠ M160), Q149 (≠ E162), Y152 (= Y165), F184 (vs. gap), M189 (= M201), K200 (≠ P212)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ A16), G18 (= G17), I19 (≠ L18), D38 (= D37), F39 (≠ L53), V59 (≠ L72), D60 (= D73), V61 (= V74), N87 (= N100), A88 (= A101), G89 (= G102), I90 (= I103), T137 (= T150), S139 (≠ G152), Y152 (= Y165), K156 (= K169), P182 (= P195), F184 (vs. gap), T185 (≠ A197), T187 (= T199), M189 (= M201)
3s55D Crystal structure of a putative short-chain dehydrogenase/reductase from mycobacterium abscessus bound to NAD (see paper)
34% identity, 66% coverage: 4:205/306 of query aligns to 2:205/275 of 3s55D
- active site: G15 (= G17), S152 (≠ G152), Y165 (= Y165), K169 (= K169)
- binding calcium ion: D52 (≠ K55), E55 (≠ R58)
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), R14 (≠ A16), M16 (≠ L18), D35 (= D37), R36 (= R44), A48 (= A51), V72 (≠ L72), D73 (= D73), V74 (= V74), N100 (= N100), A101 (= A101), G102 (= G102), I103 (= I103), T123 (≠ V123), V150 (≠ T150), S152 (≠ G152), Y165 (= Y165), K169 (= K169), P195 (= P195), G196 (≠ E196), I198 (≠ L198), T200 (≠ A200), M202 (≠ T202), T203 (≠ A203)
Sites not aligning to the query:
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
37% identity, 63% coverage: 4:195/306 of query aligns to 5:186/261 of 6zzsD
- active site: G18 (= G17), S143 (≠ G152), Y156 (= Y165)
- binding nicotinamide-adenine-dinucleotide: G14 (= G13), S17 (≠ A16), I19 (≠ L18), D38 (= D37), M39 (≠ S38), D64 (= D73), V65 (= V74), N91 (= N100), A92 (= A101), G93 (= G102), M141 (≠ T150), A142 (= A151), S143 (≠ G152), Y156 (= Y165), K160 (= K169), P186 (= P195)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ H104), S143 (≠ G152), N145 (≠ S154), K153 (≠ E162), Y156 (= Y165)
Sites not aligning to the query:
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
37% identity, 63% coverage: 4:195/306 of query aligns to 4:185/260 of 6zzqA
- active site: G17 (= G17), S142 (≠ G152), Y155 (= Y165)
- binding acetoacetic acid: Q94 (≠ H104), S142 (≠ G152), K152 (≠ E162), Y155 (= Y165)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), S16 (≠ A16), G17 (= G17), I18 (≠ L18), D37 (= D37), M38 (≠ S38), D63 (= D73), V64 (= V74), N90 (= N100), A91 (= A101), G92 (= G102), M140 (≠ T150), A141 (= A151), S142 (≠ G152), Y155 (= Y165), K159 (= K169)
Sites not aligning to the query:
1zemA Crystal structure of NAD+-bound xylitol dehydrogenase (see paper)
35% identity, 63% coverage: 3:195/306 of query aligns to 2:185/260 of 1zemA
- active site: N16 (≠ G17), S142 (≠ G152), Y155 (= Y165), K159 (= K169)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G15 (≠ A16), N16 (≠ G17), I17 (≠ L18), D36 (= D37), M37 (≠ S38), D62 (= D73), V63 (= V74), N89 (= N100), A90 (= A101), G91 (= G102), T140 (= T150), S142 (≠ G152), Y155 (= Y165), K159 (= K169), P185 (= P195)
Sites not aligning to the query:
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
32% identity, 63% coverage: 3:195/306 of query aligns to 2:177/239 of 4nbtA
- active site: G16 (= G17), S132 (≠ G152), Y145 (= Y165), K149 (= K169)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), K15 (≠ A16), G16 (= G17), L17 (= L18), D36 (= D42), L37 (≠ S43), L52 (= L72), N53 (≠ D73), V54 (= V74), N80 (= N100), A81 (= A101), G82 (= G102), I130 (≠ T150), S132 (≠ G152), Y145 (= Y165), K149 (= K169), P177 (= P195)
Sites not aligning to the query:
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
31% identity, 63% coverage: 4:195/306 of query aligns to 2:180/243 of 7emgB
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 63% coverage: 2:195/306 of query aligns to 1:181/244 of P0AEK2
- GASR 12:15 (≠ GAGA 13:16) binding
- T37 (≠ S40) binding
- NV 59:60 (≠ DV 73:74) binding
- N86 (= N100) binding
- Y151 (= Y165) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YSTSK 165:169) binding
- A154 (≠ S168) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K169) mutation to A: Defect in the affinity for NADPH.
Sites not aligning to the query:
- 184 binding
- 233 E→K: Decreases in the thermolability of the reductase; when associated with T-154.
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
31% identity, 63% coverage: 2:195/306 of query aligns to 1:181/244 of 6t77A
- active site: G16 (= G17), S138 (≠ G152), Y151 (= Y165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ G15), R15 (≠ A16), T37 (≠ S40), L58 (= L72), N59 (≠ D73), V60 (= V74), A87 (= A101), G88 (= G102), I89 (= I103)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
30% identity, 81% coverage: 2:250/306 of query aligns to 1:247/247 of 4jroC
- active site: G16 (= G17), S142 (≠ G152), Q152 (≠ E162), Y155 (= Y165), K159 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ G15), R15 (≠ A16), G16 (= G17), I17 (≠ L18), N35 (≠ I36), Y36 (≠ D37), N37 (≠ S38), G38 (= G39), S39 (= S40), N63 (≠ D73), V64 (= V74), N90 (= N100), A91 (= A101), I93 (= I103), I113 (≠ V123), S142 (≠ G152), Y155 (= Y165), K159 (= K169), P185 (= P195), I188 (≠ L198), T190 (≠ A200)
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
31% identity, 63% coverage: 4:195/306 of query aligns to 2:180/243 of 1q7bA
- active site: G15 (= G17), E101 (≠ Q116), S137 (≠ G152), Q147 (≠ E162), Y150 (= Y165), K154 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), S13 (≠ G15), R14 (≠ A16), T36 (≠ S40), N58 (≠ D73), V59 (= V74), N85 (= N100), A86 (= A101), G87 (= G102), I88 (= I103), S137 (≠ G152), Y150 (= Y165), K154 (= K169), P180 (= P195)
Sites not aligning to the query:
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
31% identity, 63% coverage: 4:195/306 of query aligns to 2:180/243 of 1q7cA
- active site: G15 (= G17), S137 (≠ G152), Q147 (≠ E162), F150 (≠ Y165), K154 (= K169)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), S13 (≠ G15), R14 (≠ A16), A35 (≠ G39), T36 (≠ S40), L57 (= L72), N58 (≠ D73), V59 (= V74), G87 (= G102), I88 (= I103)
Query Sequence
>5210113 FitnessBrowser__PV4:5210113
MMRFDEQVAVVTGAGAGLGRAYAIALAERGARLAIIDSGSGDSRCQSYAGAGLNKTARTL
AELGADCLSFQLDVTDSQALKSAIETVLKRWGRIDIAINNAGIHTPVSFDSLSFEQWQRQ
LDVDLNGSFHLTKLVWPQMKRQNYGRIVMTAGASGLYGDMHETPYSTSKMALVGLVNSLA
KEGRDYNISVNTLVPEALTAMTAHHLSPLVKPLFSTSSVNATLLYLCSSTACSGQHLLAA
AGSVSHGMFVEFQPLRIVEDGCKPEVIAQRWDELYRAQPCHFHESGEEQVTAWARRSAAE
HHVDIE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory