SitesBLAST
Comparing 5210798 FitnessBrowser__PV4:5210798 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3a52A Crystal structure of cold-active alkailne phosphatase from psychrophile shewanella sp. (see paper)
70% identity, 73% coverage: 39:434/543 of query aligns to 3:398/400 of 3a52A
- active site: D9 (= D45), S58 (= S94), H109 (= H145), T111 (= T147), R122 (= R158), E222 (= E258), D227 (= D263), W228 (= W264), H231 (= H267), D269 (= D305), H270 (= H306), H362 (= H398)
- binding magnesium ion: H109 (= H145), T111 (= T147), E222 (= E258), S276 (= S312), I277 (= I313), T363 (= T399), V365 (= V401)
- binding zinc ion: D227 (= D263), H231 (= H267), H362 (= H398)
1ajbA Three-dimensional structure of the d153g mutant of e. Coli alkaline phosphatase: a mutant with weaker magnesium binding and increased catalytic activity (see paper)
35% identity, 52% coverage: 23:306/543 of query aligns to 22:370/449 of 1ajbA
- active site: D51 (= D45), S102 (= S94), G153 (≠ H145), T155 (= T147), R166 (= R158), E322 (= E258), D327 (= D263), K328 (≠ W264), H331 (= H267), D369 (= D305), H370 (= H306)
- binding magnesium ion: D51 (= D45), T155 (= T147), E322 (= E258)
- binding zinc ion: D51 (= D45), S102 (= S94), D327 (= D263), H331 (= H267), D369 (= D305), H370 (= H306)
Sites not aligning to the query:
1kh5A E. Coli alkaline phosphatase mutant (d330n) mimic of the transition states with aluminium fluoride (see paper)
34% identity, 52% coverage: 23:306/543 of query aligns to 17:365/444 of 1kh5A
Sites not aligning to the query:
5c66A E. Coli alkaline phosphatase in complex with tungstate (see paper)
34% identity, 52% coverage: 23:306/543 of query aligns to 14:362/441 of 5c66A
- active site: D43 (= D45), S94 (= S94), D145 (≠ H145), T147 (= T147), R158 (= R158), E314 (= E258), D319 (= D263), K320 (≠ W264), H323 (= H267), D361 (= D305), H362 (= H306)
- binding tungstate(vi)ion: D43 (= D45), D93 (= D93), S94 (= S94), R158 (= R158), D319 (= D263), H323 (= H267), H362 (= H306)
- binding zinc ion: D43 (= D45), D43 (= D45), S94 (= S94), T147 (= T147), E314 (= E258), D319 (= D263), H323 (= H267), D361 (= D305), H362 (= H306)
Sites not aligning to the query:
1y6vA Structure of e. Coli alkaline phosphatase in presence of cobalt at 1.60 a resolution (see paper)
34% identity, 52% coverage: 23:306/543 of query aligns to 22:370/449 of 1y6vA
- active site: D51 (= D45), S102 (= S94), D153 (≠ H145), T155 (= T147), R166 (= R158), E322 (= E258), D327 (= D263), K328 (≠ W264), H331 (= H267), D369 (= D305), H370 (= H306)
- binding cobalt (ii) ion: D51 (= D45), D51 (= D45), S102 (= S94), T155 (= T147), E322 (= E258), D327 (= D263), D327 (= D263), H331 (= H267), D369 (= D305), H370 (= H306)
- binding phosphate ion: D101 (= D93), S102 (= S94), R166 (= R158), D327 (= D263), H370 (= H306)
Sites not aligning to the query:
1ew9A Alkaline phosphatase (E.C. 3.1.3.1) complex with mercaptomethyl phosphonate (see paper)
34% identity, 52% coverage: 23:306/543 of query aligns to 22:370/449 of 1ew9A
- active site: D51 (= D45), S102 (= S94), D153 (≠ H145), T155 (= T147), R166 (= R158), E322 (= E258), D327 (= D263), K328 (≠ W264), H331 (= H267), D369 (= D305), H370 (= H306)
- binding magnesium ion: D51 (= D45), T155 (= T147), E322 (= E258)
- binding mercaptomethyl phosphonate: S102 (= S94), R166 (= R158), D327 (= D263), H331 (= H267)
- binding zinc ion: D51 (= D45), D51 (= D45), S102 (= S94), T155 (= T147), E322 (= E258), D327 (= D263), H331 (= H267), D369 (= D305), H370 (= H306)
Sites not aligning to the query:
1ew8A Alkaline phosphatase (E.C. 3.1.3.1) complex with phosphonoacetic acid (see paper)
34% identity, 52% coverage: 23:306/543 of query aligns to 22:370/449 of 1ew8A
- active site: D51 (= D45), S102 (= S94), D153 (≠ H145), T155 (= T147), R166 (= R158), E322 (= E258), D327 (= D263), K328 (≠ W264), H331 (= H267), D369 (= D305), H370 (= H306)
- binding magnesium ion: D51 (= D45), T155 (= T147), E322 (= E258)
- binding phosphonoacetic acid: D51 (= D45), D101 (= D93), S102 (= S94), R166 (= R158), D327 (= D263)
- binding phosphate ion: D51 (= D45), S102 (= S94), R166 (= R158), D327 (= D263)
- binding zinc ion: D51 (= D45), D51 (= D45), T155 (= T147), E322 (= E258), D327 (= D263), H331 (= H267), D369 (= D305), H370 (= H306)
Sites not aligning to the query:
1alhA Kinetics and crystal structure of a mutant e. Coli alkaline phosphatase (asp-369-->asn): a mechanism involving one zinc per active site (see paper)
34% identity, 52% coverage: 23:306/543 of query aligns to 19:367/446 of 1alhA
- active site: D48 (= D45), S99 (= S94), D150 (≠ H145), T152 (= T147), R163 (= R158), E319 (= E258), D324 (= D263), K325 (≠ W264), H328 (= H267), N366 (≠ D305), H367 (= H306)
- binding phosphate ion: S99 (= S94), R163 (= R158), H328 (= H267)
- binding zinc ion: D324 (= D263), H328 (= H267)
Sites not aligning to the query:
7qowB Crystal structure of vibrio alkaline phosphatase in 1.0 m nacl (see paper)
33% identity, 51% coverage: 37:313/543 of query aligns to 4:323/505 of 7qowB
- binding chloride ion: R129 (= R158)
- binding magnesium ion: D12 (= D45), A45 (vs. gap), Q46 (vs. gap), G48 (vs. gap), T118 (= T147), E268 (= E258)
- binding phosphate ion: S65 (= S94), R129 (= R158), D273 (= D263)
- binding zinc ion: D12 (= D45), S65 (= S94), D273 (= D263), H277 (= H267), D315 (= D305), H316 (= H306)
Sites not aligning to the query:
3dpcB Structure of e.Coli alkaline phosphatase mutant in complex with a phosphorylated peptide (see paper)
34% identity, 52% coverage: 23:306/543 of query aligns to 21:369/448 of 3dpcB
- active site: D50 (= D45), L101 (≠ S94), D152 (≠ H145), T154 (= T147), R165 (= R158), E321 (= E258), D326 (= D263), K327 (≠ W264), H330 (= H267), D368 (= D305), H369 (= H306)
- binding : L101 (≠ S94), Y115 (= Y108), N116 (= N109), G117 (= G110), R165 (= R158), K166 (≠ R159)
Sites not aligning to the query:
3wbhA Structural characteristics of alkaline phosphatase from a moderately halophilic bacteria halomonas sp.593 (see paper)
33% identity, 51% coverage: 37:313/543 of query aligns to 3:318/497 of 3wbhA
- active site: D11 (= D45), S64 (= S94), H115 (= H145), T117 (= T147), R128 (= R158), E263 (= E258), D268 (= D263), W269 (= W264), H272 (= H267), D310 (= D305), H311 (= H306)
- binding magnesium ion: D11 (= D45), A44 (vs. gap), K45 (vs. gap), G47 (vs. gap), G102 (= G132), T117 (= T147), D254 (≠ N249), D256 (≠ Q251), E263 (= E258)
- binding zinc ion: D11 (= D45), S64 (= S94), D268 (= D263), H272 (= H267), D310 (= D305), H311 (= H306)
Sites not aligning to the query:
2x98A H.Salinarum alkaline phosphatase (see paper)
35% identity, 71% coverage: 38:422/543 of query aligns to 6:416/430 of 2x98A
- active site: D13 (= D45), S72 (= S94), H127 (= H145), T129 (= T147), R140 (= R158), E256 (= E258), D261 (= D263), H262 (≠ W264), H265 (= H267), D303 (= D305), H304 (= H306), H392 (= H398)
- binding magnesium ion: D13 (= D45), Y115 (≠ M133), T129 (= T147), D239 (≠ E244), S242 (= S247), D248 (= D250), E256 (= E258), E318 (≠ R320), E320 (≠ D322)
- binding phosphate ion: D71 (= D93), S72 (= S94), R140 (= R158), D261 (= D263), H304 (= H306), H392 (= H398)
- binding zinc ion: D13 (= D45), D261 (= D263), H265 (= H267), D303 (= D305), H304 (= H306), H392 (= H398)
Sites not aligning to the query:
2iucA Structure of alkaline phosphatase from the antarctic bacterium tab5 (see paper)
32% identity, 52% coverage: 36:320/543 of query aligns to 3:285/340 of 2iucA
- active site: D12 (= D45), S53 (= S94), H104 (= H145), T106 (= T147), R117 (= R158), E223 (= E258), D228 (= D263), W229 (= W264), H232 (= H267), D270 (= D305), H271 (= H306)
- binding magnesium ion: D12 (= D45), T106 (= T147), H113 (= H154), E122 (≠ A163), D126 (≠ S167), E223 (= E258), N235 (≠ D270), S237 (≠ A272)
- binding phosphate ion: S53 (= S94), R117 (= R158)
- binding zinc ion: D12 (= D45), S53 (= S94), D228 (= D263), H232 (= H267), D270 (= D305), H271 (= H306)
Sites not aligning to the query:
7tm9A Crystal structure of bacterial alkaline phosphatase from klebsiella pneumoniae
34% identity, 50% coverage: 37:306/543 of query aligns to 35:362/441 of 7tm9A
Sites not aligning to the query:
2w5vA Structure of tab5 alkaline phosphatase mutant his 135 asp with mg bound in the m3 site. (see paper)
32% identity, 53% coverage: 36:322/543 of query aligns to 5:289/346 of 2w5vA
- active site: D14 (= D45), S55 (= S94), D106 (≠ H145), T108 (= T147), R119 (= R158), E225 (= E258), D230 (= D263), W231 (= W264), H234 (= H267), D272 (= D305), H273 (= H306)
- binding magnesium ion: D14 (= D45), T108 (= T147), E225 (= E258), N237 (≠ D270), S239 (≠ A272)
- binding zinc ion: D14 (= D45), S55 (= S94), S55 (= S94), D230 (= D263), H234 (= H267), D272 (= D305), H273 (= H306)
Sites not aligning to the query:
Q02QC9 Alkaline phosphatase H; High molecular weight phosphatase; H-AP; EC 3.1.3.1 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see 2 papers)
33% identity, 50% coverage: 35:306/543 of query aligns to 67:396/476 of Q02QC9
- S128 (= S94) active site, Phosphoserine intermediate; modified: Phosphoserine
- S206 (vs. gap) modified: Phosphoserine
7kwdA Crystal structure of thermus thermophilus alkaline phosphatase (see paper)
29% identity, 73% coverage: 30:424/543 of query aligns to 13:444/473 of 7kwdA
- active site: D31 (= D45), S79 (= S94), H130 (= H145), T132 (= T147), R143 (= R158), E254 (= E258), D259 (= D263), H260 (≠ W264), H263 (= H267), D301 (= D305), H302 (= H306), H417 (= H398)
- binding magnesium ion: D31 (= D45), T132 (= T147), E254 (= E258)
- binding zinc ion: D31 (= D45), S79 (= S94), D259 (= D263), H263 (= H267), D301 (= D305), H302 (= H306), H417 (= H398)
P19111 Intestinal-type alkaline phosphatase; IAP; Intestinal alkaline phosphatase; EC 3.1.3.1 from Bos taurus (Bovine) (see 2 papers)
28% identity, 72% coverage: 37:428/543 of query aligns to 53:481/533 of P19111
- S111 (= S94) active site, Phosphoserine intermediate
Sites not aligning to the query:
P05187 Alkaline phosphatase, placental type; Alkaline phosphatase Regan isozyme; Placental alkaline phosphatase 1; PLAP-1; EC 3.1.3.1 from Homo sapiens (Human) (see 11 papers)
29% identity, 73% coverage: 30:428/543 of query aligns to 49:484/535 of P05187
- D64 (= D45) binding ; binding
- I89 (= I67) to L: in dbSNP:rs13026692
- S114 (= S94) binding
- C143 (vs. gap) modified: Disulfide link with 205
- N144 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- S177 (≠ T147) binding
- C205 (vs. gap) modified: Disulfide link with 143
- R231 (vs. gap) to P: in dbSNP:rs1048988
- R263 (vs. gap) to H: in dbSNP:rs2853378
- N271 (≠ K201) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- E333 (= E258) binding
- D338 (= D263) binding
- H342 (= H267) binding
- D379 (= D305) binding
- H380 (= H306) binding
- H454 (= H398) binding
Sites not aligning to the query:
- 1:22 signal peptide
- 25 P → L: in dbSNP:rs1130335
- 489 modified: Disulfide link with 496
- 496 modified: Disulfide link with 489
- 506 modified: GPI-anchor amidated aspartate
3mk0A Refinement of placental alkaline phosphatase complexed with nitrophenyl (see paper)
29% identity, 73% coverage: 30:428/543 of query aligns to 27:462/481 of 3mk0A
- active site: D42 (= D45), S92 (= S94), H153 (= H145), S155 (≠ T147), R166 (= R158), E311 (= E258), D316 (= D263), H317 (≠ W264), H320 (= H267), D357 (= D305), H358 (= H306), H432 (= H398)
- binding calcium ion: E216 (vs. gap), F269 (= F218), E270 (≠ A219), D285 (≠ A232)
- binding magnesium ion: D42 (= D45), S155 (≠ T147), E311 (= E258)
- binding p-nitrophenol: G211 (vs. gap), P213 (vs. gap), P218 (vs. gap), Y221 (vs. gap), R250 (≠ D202), L253 (= L205), M254 (≠ L206), S257 (≠ V209), E290 (≠ T237), A294 (≠ K241), R297 (≠ E244)
- binding zinc ion: D42 (= D45), S92 (= S94), S92 (= S94), D316 (= D263), H320 (= H267), D357 (= D305), H358 (= H306), H432 (= H398)
Query Sequence
>5210798 FitnessBrowser__PV4:5210798
MKLTRLCSLLCLGAALVSGSLWADNLLGPQTAPSRPKNIVIMVGDGMGPAYTSAYRYYQD
NPNTQEIEQTVFDRLLVGNASTYPAPVSGYVTDSAAAATALATGVKTYNGAVSVDIDKRP
VPTLLELAKKRGMSTGVTVTSQINHATPAAFLSHNESRRNYEALAQSYLSTDADVMLGGG
QKYFSDKLIKQFEAKGYRVLKDSALLEGVTQPKVMGLFADVQLPWAIDEPEARRLSTMTA
KALELLSQNDQGFVLLVEGSLIDWAGHNNDIATAMAEMHEFASAIEVVEQYVRQHQDTLL
VVTADHNTGGLSIGKQGEYRWDSQMLRQISASPTQIAKQALALDEWRSGVSGALGFTPSD
DEFSALDNARMQGEQVLTTQLKKLIDQRSNTGWTTGGHTGVDVQVFAAGPASSLFAGHQD
NTDIAHKLISLLPKAAKAKPEAKQAPAKPLEPKAAKPVEAEPEAAPQETEVKVEVESKAK
DLIDSQVLPKEDVKPAAEGQSAASDSNAKKMDAKQTLQQAEDLLSEGAESQSAAPVSQVD
NQD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory