Comparing 5211333 FitnessBrowser__PV4:5211333 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
3w7uA Escherichia coli k12 ygjk complexed with galactose (see paper)
36% identity, 96% coverage: 30:735/738 of query aligns to 1:757/760 of 3w7uA
3w7tA Escherichia coli k12 ygjk complexed with mannose (see paper)
36% identity, 96% coverage: 30:735/738 of query aligns to 1:757/760 of 3w7tA
3w7sA Escherichia coli k12 ygjk complexed with glucose (see paper)
36% identity, 96% coverage: 30:735/738 of query aligns to 1:757/760 of 3w7sA
5gw7B Crystal structure of the glycosynthase mutant e727a of escherichia coli gh63 glycosidase in complex with glucose and lactose (see paper)
36% identity, 96% coverage: 30:735/738 of query aligns to 1:757/760 of 5gw7B
6xuxA Crystal structure of megabody mb-nb207-cygjk_no (see paper)
36% identity, 61% coverage: 30:479/738 of query aligns to 309:762/879 of 6xuxA
Sites not aligning to the query:
4wvbA Crystal structure of gh63 mannosylglycerate hydrolase from thermus thermophilus hb8 in complex with glucose (see paper)
29% identity, 52% coverage: 347:732/738 of query aligns to 30:394/394 of 4wvbA
4wvcA Crystal structure of gh63 mannosylglycerate hydrolase from thermus thermophilus hb8 in complex with tris and d-glycerate (see paper)
28% identity, 52% coverage: 347:732/738 of query aligns to 30:413/413 of 4wvcA
6g3nA Mycobacterial hydrolase complex 14.
24% identity, 52% coverage: 346:728/738 of query aligns to 38:441/445 of 6g3nA
K5BDL0 Glucosylglycerate hydrolase; GG hydrolase; EC 3.2.1.208 from Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) (Mycobacterium hassiacum) (see paper)
23% identity, 52% coverage: 346:728/738 of query aligns to 39:442/446 of K5BDL0
Sites not aligning to the query:
5onzA Crystal structure of mycolicibacterium hassiacum glucosylglycerate hydrolase (mhggh) d182a variant in complex with glucosylglycolate (see paper)
23% identity, 52% coverage: 346:728/738 of query aligns to 38:441/445 of 5onzA
Sites not aligning to the query:
5oj4A Crystal structure of mycolicibacterium hassiacum glucosylglycerate hydrolase (mhggh) d182a variant in complex with mannosylglycerate (see paper)
23% identity, 52% coverage: 346:728/738 of query aligns to 38:441/445 of 5oj4A
Sites not aligning to the query:
5oiwA Crystal structure of mycolicibacterium hassiacum glucosylglycerate hydrolase (mhggh) d182a variant in complex with glucosylglycerate (see paper)
23% identity, 52% coverage: 346:728/738 of query aligns to 38:441/445 of 5oiwA
Sites not aligning to the query:
5oivA Crystal structure of mycolicibacterium hassiacum glucosylglycerate hydrolase (mhggh) d43a variant in complex with serine and glycerol (see paper)
23% identity, 52% coverage: 346:728/738 of query aligns to 38:441/445 of 5oivA
5ontA Crystal structure of mycolicibacterium hassiacum glucosylglycerate hydrolase(mhggh) e419a variant in complex with glucosylglycerol (see paper)
23% identity, 52% coverage: 346:728/738 of query aligns to 38:436/440 of 5ontA
Sites not aligning to the query:
5n6nC Crystal structure of the 14-3-3:neutral trehalase nth1 complex (see paper)
27% identity, 27% coverage: 519:716/738 of query aligns to 424:632/698 of 5n6nC
Sites not aligning to the query:
P32356 Cytosolic neutral trehalase; Alpha,alpha-trehalase; Alpha,alpha-trehalose glucohydrolase; EC 3.2.1.28 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
27% identity, 27% coverage: 519:716/738 of query aligns to 477:685/751 of P32356
Sites not aligning to the query:
>5211333 FitnessBrowser__PV4:5211333
MTRLPALSVRRLLLLSLSLLCSLPSVSVAQASEYRDLLNYRGTPSNMEQRDPQGNLTIPA
VYMDQGAWHGFHLPDSPAYYGGFTGPLFIAQEYSLHLSDSLQKLQLFSGESGQSVDLAKA
EQVEIYSEPWGLVQRFRFKDLELSTTLEYSDNRTAIVSTRLINLSDKPGSWRLSWSGSPF
ATHPKLKQYRLVDKRLLSEDAVTWQFTPIDQTWQMQLDDASYRLAFEQAVTLSVEGPQGY
RADSGLLTLAPGEATVLRAAHQYFHTQVEARHAAKLDWPTVTAKLAVNRSRWQQRLDKLV
RGGELPARRLAAKSMMTLLHNWRSPAGALLHDAVTPSVTYKWFNGVWAWDSWKQAVALAQ
FDVALAELNVLAMFDYQFDAKDPLRPEDAGNLPDAIFYNPDASRGGKGGNWNERNGKPPL
AAWAVWQIYQQSQDKALITRLYPKLVAYHEWWYRNRDHNHNGLAEYGANRHPRHGEPGEP
GEPGEPDREAVIEAAAWESGMDNAPRFDMGDELQVLENYDAKGRLLGYSISQESVDLNSY
LYAEKGYLAQMAELLDLDSEAAVWREQAARLGQLIRSEFFDEESGFFYDRRLAGERSRLM
IAEGKGVEGWLPLWAGAASQAQAEQMIATQLNASNFGTKLPFPTVSADNSAFAPRRYWRG
PVWLDQALFGLQGVSRYGHDELARRLATRLVNEADGVLGDGPIRENYDPLTGDGLHCTNF
SWSASVLLLIYRSWLSTD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory