SitesBLAST
Comparing 6936385 FitnessBrowser__SB2B:6936385 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3a52A Crystal structure of cold-active alkailne phosphatase from psychrophile shewanella sp. (see paper)
68% identity, 80% coverage: 32:427/492 of query aligns to 3:398/400 of 3a52A
- active site: D9 (= D38), S58 (= S87), H109 (= H138), T111 (= T140), R122 (= R151), E222 (= E251), D227 (= D256), W228 (= W257), H231 (= H260), D269 (= D298), H270 (= H299), H362 (= H391)
- binding magnesium ion: H109 (= H138), T111 (= T140), E222 (= E251), S276 (= S305), I277 (= I306), T363 (= T392), V365 (≠ L394)
- binding zinc ion: D227 (= D256), H231 (= H260), H362 (= H391)
7qowB Crystal structure of vibrio alkaline phosphatase in 1.0 m nacl (see paper)
33% identity, 57% coverage: 30:310/492 of query aligns to 4:329/505 of 7qowB
- binding chloride ion: R129 (= R151)
- binding magnesium ion: D12 (= D38), A45 (≠ L68), Q46 (≠ L69), G48 (= G71), T118 (= T140), E268 (= E251)
- binding phosphate ion: S65 (= S87), R129 (= R151), D273 (= D256)
- binding zinc ion: D12 (= D38), S65 (= S87), D273 (= D256), H277 (= H260), D315 (= D298), H316 (= H299)
Sites not aligning to the query:
5c66A E. Coli alkaline phosphatase in complex with tungstate (see paper)
34% identity, 58% coverage: 16:299/492 of query aligns to 22:362/441 of 5c66A
- active site: D43 (= D38), S94 (= S87), D145 (≠ H138), T147 (= T140), R158 (= R151), E314 (= E251), D319 (= D256), K320 (≠ W257), H323 (= H260), D361 (= D298), H362 (= H299)
- binding tungstate(vi)ion: D43 (= D38), D93 (= D86), S94 (= S87), R158 (= R151), D319 (= D256), H323 (= H260), H362 (= H299)
- binding zinc ion: D43 (= D38), D43 (= D38), S94 (= S87), T147 (= T140), E314 (= E251), D319 (= D256), H323 (= H260), D361 (= D298), H362 (= H299)
Sites not aligning to the query:
1kh5A E. Coli alkaline phosphatase mutant (d330n) mimic of the transition states with aluminium fluoride (see paper)
34% identity, 55% coverage: 28:299/492 of query aligns to 35:365/444 of 1kh5A
Sites not aligning to the query:
1y6vA Structure of e. Coli alkaline phosphatase in presence of cobalt at 1.60 a resolution (see paper)
34% identity, 58% coverage: 16:299/492 of query aligns to 30:370/449 of 1y6vA
- active site: D51 (= D38), S102 (= S87), D153 (≠ H138), T155 (= T140), R166 (= R151), E322 (= E251), D327 (= D256), K328 (≠ W257), H331 (= H260), D369 (= D298), H370 (= H299)
- binding cobalt (ii) ion: D51 (= D38), D51 (= D38), S102 (= S87), T155 (= T140), E322 (= E251), D327 (= D256), D327 (= D256), H331 (= H260), D369 (= D298), H370 (= H299)
- binding phosphate ion: D101 (= D86), S102 (= S87), R166 (= R151), D327 (= D256), H370 (= H299)
Sites not aligning to the query:
1ew9A Alkaline phosphatase (E.C. 3.1.3.1) complex with mercaptomethyl phosphonate (see paper)
34% identity, 58% coverage: 16:299/492 of query aligns to 30:370/449 of 1ew9A
- active site: D51 (= D38), S102 (= S87), D153 (≠ H138), T155 (= T140), R166 (= R151), E322 (= E251), D327 (= D256), K328 (≠ W257), H331 (= H260), D369 (= D298), H370 (= H299)
- binding magnesium ion: D51 (= D38), T155 (= T140), E322 (= E251)
- binding mercaptomethyl phosphonate: S102 (= S87), R166 (= R151), D327 (= D256), H331 (= H260)
- binding zinc ion: D51 (= D38), D51 (= D38), S102 (= S87), T155 (= T140), E322 (= E251), D327 (= D256), H331 (= H260), D369 (= D298), H370 (= H299)
Sites not aligning to the query:
1ew8A Alkaline phosphatase (E.C. 3.1.3.1) complex with phosphonoacetic acid (see paper)
34% identity, 58% coverage: 16:299/492 of query aligns to 30:370/449 of 1ew8A
- active site: D51 (= D38), S102 (= S87), D153 (≠ H138), T155 (= T140), R166 (= R151), E322 (= E251), D327 (= D256), K328 (≠ W257), H331 (= H260), D369 (= D298), H370 (= H299)
- binding magnesium ion: D51 (= D38), T155 (= T140), E322 (= E251)
- binding phosphonoacetic acid: D51 (= D38), D101 (= D86), S102 (= S87), R166 (= R151), D327 (= D256)
- binding phosphate ion: D51 (= D38), S102 (= S87), R166 (= R151), D327 (= D256)
- binding zinc ion: D51 (= D38), D51 (= D38), T155 (= T140), E322 (= E251), D327 (= D256), H331 (= H260), D369 (= D298), H370 (= H299)
Sites not aligning to the query:
1ajbA Three-dimensional structure of the d153g mutant of e. Coli alkaline phosphatase: a mutant with weaker magnesium binding and increased catalytic activity (see paper)
34% identity, 58% coverage: 16:299/492 of query aligns to 30:370/449 of 1ajbA
- active site: D51 (= D38), S102 (= S87), G153 (≠ H138), T155 (= T140), R166 (= R151), E322 (= E251), D327 (= D256), K328 (≠ W257), H331 (= H260), D369 (= D298), H370 (= H299)
- binding magnesium ion: D51 (= D38), T155 (= T140), E322 (= E251)
- binding zinc ion: D51 (= D38), S102 (= S87), D327 (= D256), H331 (= H260), D369 (= D298), H370 (= H299)
Sites not aligning to the query:
1alhA Kinetics and crystal structure of a mutant e. Coli alkaline phosphatase (asp-369-->asn): a mechanism involving one zinc per active site (see paper)
34% identity, 58% coverage: 16:299/492 of query aligns to 27:367/446 of 1alhA
- active site: D48 (= D38), S99 (= S87), D150 (≠ H138), T152 (= T140), R163 (= R151), E319 (= E251), D324 (= D256), K325 (≠ W257), H328 (= H260), N366 (≠ D298), H367 (= H299)
- binding phosphate ion: S99 (= S87), R163 (= R151), H328 (= H260)
- binding zinc ion: D324 (= D256), H328 (= H260)
Sites not aligning to the query:
3dpcB Structure of e.Coli alkaline phosphatase mutant in complex with a phosphorylated peptide (see paper)
34% identity, 58% coverage: 16:299/492 of query aligns to 29:369/448 of 3dpcB
- active site: D50 (= D38), L101 (≠ S87), D152 (≠ H138), T154 (= T140), R165 (= R151), E321 (= E251), D326 (= D256), K327 (≠ W257), H330 (= H260), D368 (= D298), H369 (= H299)
- binding : L101 (≠ S87), Y115 (= Y101), N116 (= N102), G117 (= G103), R165 (= R151), K166 (= K152)
Sites not aligning to the query:
3wbhA Structural characteristics of alkaline phosphatase from a moderately halophilic bacteria halomonas sp.593 (see paper)
35% identity, 57% coverage: 30:310/492 of query aligns to 3:324/497 of 3wbhA
- active site: D11 (= D38), S64 (= S87), H115 (= H138), T117 (= T140), R128 (= R151), E263 (= E251), D268 (= D256), W269 (= W257), H272 (= H260), D310 (= D298), H311 (= H299)
- binding magnesium ion: D11 (= D38), A44 (vs. gap), K45 (vs. gap), G47 (vs. gap), G102 (= G125), T117 (= T140), D254 (≠ N242), D256 (≠ K244), E263 (= E251)
- binding zinc ion: D11 (= D38), S64 (= S87), D268 (= D256), H272 (= H260), D310 (= D298), H311 (= H299)
Sites not aligning to the query:
2iucA Structure of alkaline phosphatase from the antarctic bacterium tab5 (see paper)
33% identity, 57% coverage: 29:308/492 of query aligns to 3:280/340 of 2iucA
- active site: D12 (= D38), S53 (= S87), H104 (= H138), T106 (= T140), R117 (= R151), E223 (= E251), D228 (= D256), W229 (= W257), H232 (= H260), D270 (= D298), H271 (= H299)
- binding magnesium ion: D12 (= D38), T106 (= T140), H113 (= H147), E122 (= E156), D126 (≠ A160), E223 (= E251), N235 (≠ D263), S237 (≠ V265)
- binding phosphate ion: S53 (= S87), R117 (= R151)
- binding zinc ion: D12 (= D38), S53 (= S87), D228 (= D256), H232 (= H260), D270 (= D298), H271 (= H299)
Sites not aligning to the query:
2x98A H.Salinarum alkaline phosphatase (see paper)
34% identity, 79% coverage: 27:415/492 of query aligns to 2:416/430 of 2x98A
- active site: D13 (= D38), S72 (= S87), H127 (= H138), T129 (= T140), R140 (= R151), E256 (= E251), D261 (= D256), H262 (≠ W257), H265 (= H260), D303 (= D298), H304 (= H299), H392 (= H391)
- binding magnesium ion: S2 (= S27), A4 (≠ P29), D13 (= D38), Y115 (≠ L126), T129 (= T140), D239 (≠ E237), S242 (= S240), D248 (= D243), E256 (= E251), E318 (≠ L313), E320 (≠ D315)
- binding phosphate ion: D71 (= D86), S72 (= S87), R140 (= R151), D261 (= D256), H304 (= H299), H392 (= H391)
- binding zinc ion: D13 (= D38), D261 (= D256), H265 (= H260), D303 (= D298), H304 (= H299), H392 (= H391)
7tm9A Crystal structure of bacterial alkaline phosphatase from klebsiella pneumoniae
32% identity, 58% coverage: 27:311/492 of query aligns to 31:374/441 of 7tm9A
Sites not aligning to the query:
2w5vA Structure of tab5 alkaline phosphatase mutant his 135 asp with mg bound in the m3 site. (see paper)
34% identity, 58% coverage: 23:308/492 of query aligns to 2:282/346 of 2w5vA
- active site: D14 (= D38), S55 (= S87), D106 (≠ H138), T108 (= T140), R119 (= R151), E225 (= E251), D230 (= D256), W231 (= W257), H234 (= H260), D272 (= D298), H273 (= H299)
- binding magnesium ion: D14 (= D38), T108 (= T140), E225 (= E251), N237 (≠ D263), S239 (≠ V265)
- binding zinc ion: D14 (= D38), S55 (= S87), S55 (= S87), D230 (= D256), H234 (= H260), D272 (= D298), H273 (= H299)
Sites not aligning to the query:
7kwdA Crystal structure of thermus thermophilus alkaline phosphatase (see paper)
29% identity, 80% coverage: 28:421/492 of query aligns to 21:448/473 of 7kwdA
- active site: D31 (= D38), S79 (= S87), H130 (= H138), T132 (= T140), R143 (= R151), E254 (= E251), D259 (= D256), H260 (≠ W257), H263 (= H260), D301 (= D298), H302 (= H299), H417 (= H391)
- binding magnesium ion: D31 (= D38), T132 (= T140), E254 (= E251)
- binding zinc ion: D31 (= D38), S79 (= S87), D259 (= D256), H263 (= H260), D301 (= D298), H302 (= H299), H417 (= H391)
Q02QC9 Alkaline phosphatase H; High molecular weight phosphatase; H-AP; EC 3.1.3.1 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see 2 papers)
31% identity, 55% coverage: 28:299/492 of query aligns to 67:396/476 of Q02QC9
- S128 (= S87) active site, Phosphoserine intermediate; modified: Phosphoserine
- S206 (vs. gap) modified: Phosphoserine
P05186 Alkaline phosphatase, tissue-nonspecific isozyme; AP-TNAP; TNS-ALP; TNSALP; Alkaline phosphatase liver/bone/kidney isozyme; Phosphoamidase; Phosphocreatine phosphatase; EC 3.1.3.1; EC 3.9.1.1 from Homo sapiens (Human) (see 39 papers)
29% identity, 55% coverage: 30:299/492 of query aligns to 52:379/524 of P05186
- M62 (= M40) to L: in HOPS; moderate; 27% of activity
- G63 (= G41) to V: in HOPS; loss of activity
- T68 (≠ S46) to M: in HPPC; severe allele
- R71 (= R49) to C: in HOPS; abolished alkaline phosphatase activity; dbSNP:rs121918001; to H: in HOPS; loss of alkaline phosphatase activity; dbSNP:rs121918003; to P: in HOPS; abolished alkaline phosphatase activity; dbSNP:rs121918003; to S: in HPPC; severe allele; dbSNP:rs121918001
- G75 (vs. gap) to S: in HOPS; severe; 3.5% of activity; dbSNP:rs1304394441
- G82 (≠ D56) to R: in HOPS; dominant-negative mutant; abolished alkaline phosphatase activity
- P108 (≠ T85) to L: in HOPS; 0.4% of alkaline phosphatase activity; severe allele; no effect on subcellular location; fails to assemble into dimeric structure; dominant negative effect; dbSNP:rs121918015
- A111 (= A88) to T: in HOPS; odonto; abolished alkaline phosphatase activity; dbSNP:rs773257111
- A116 (= A93) to T: in HOPS; loss of alkaline phosphatase activity; dbSNP:rs121918013
- A132 (vs. gap) to V: in HOPS; strongly reduced alkaline phosphatase activity
- T134 (vs. gap) to H: in HOPS; requires 2 nucleotide substitutions; dbSNP:rs786204530; to N: in HOPS; 9% of activity; dbSNP:rs780583917
- R136 (vs. gap) to H: in HOPS; moderate; 33% of activity; dbSNP:rs121918011
- R152 (≠ E119) to C: in HOPS; uncertain significance; to H: in HOPS; benign; lethal form; dbSNP:rs149344982
- G162 (= G129) to V: in HOPS; severe; 1% of activity; dbSNP:rs121918012
- H171 (= H138) to Y: in HOPS; severe; 2% of activity
- A176 (= A143) to T: in HOPS; 30% of alkaline phosphatase activity; dbSNP:rs121918019
- A177 (≠ F144) to T: in HOPS and HPPC; moderate allele; normal alkaline phosphatase activity toward diphosphate and increased activity toward pyridoxal 5'-phosphate; dbSNP:rs199669988
- A179 (= A146) to T: in HOPS; reduced alkaline phosphatase activity toward diphosphate and pyridoxal 5'-phosphate; dbSNP:rs121918000
- S181 (≠ N148) to L: in HOPS; 1% of activity; dbSNP:rs199590449
- R184 (= R151) to W: in HOPS; loss of activity; dbSNP:rs763159520
- S188 (≠ D155) to P: in HOPS; uncertain significance
- E191 (vs. gap) to G: in HOPS; odonto; slightly reduced alkaline phosphatase activity; to K: in HOPS; moderate; frequent mutation in European countries; slightly reduced alkaline phosphatase activity; dbSNP:rs121918007
- C201 (vs. gap) to Y: in HOPS; weak alkaline phosphatase activity; severely affects homodimerization; reduced cell surface expression
- I218 (≠ L169) to S: in HOPS; uncertain significance
- G220 (= G171) to V: in HOPS; odonto
- R223 (≠ Q174) to W: in HOPS and HPPC; severe allele; abolished alkaline phosphatase activity; dbSNP:rs766076920
- K224 (= K175) to E: in HPPI; partial loss of activity; dbSNP:rs1226800998
- E235 (≠ S180) binding ; mutation to A: Abolished alkaline phosphatase activity.
- R246 (vs. gap) to S: in HOPS; 4% of activity; dbSNP:rs1223142821
- G249 (vs. gap) to V: in HOPS; partial loss of activity; dbSNP:rs121918018
- Y263 (= Y190) to H: in dbSNP:rs3200254
- W270 (vs. gap) mutation to A: Reduced alkaline phosphatase activity.
- R272 (≠ L193) to H: in HOPS; 6.8% of wild-type activity; dbSNP:rs781272386; mutation to A: Reduced alkaline phosphatase activity.
- L275 (≠ I196) to P: in HPPC; severe allele; dbSNP:rs1237252052
- F290 (= F211) binding ; mutation to A: Abolished alkaline phosphatase activity.
- E291 (vs. gap) binding ; to K: in HOPS; moderate; 8% of activity; dbSNP:rs786204473; mutation to A: Reduced alkaline phosphatase activity.
- P292 (vs. gap) to T: in HOPS; 4% of wild-type activity; dbSNP:rs765458125
- D294 (≠ E213) to A: in HOPS; reduced alkaline phosphatase toward diphosphate and pyridoxal 5'-phosphate; dbSNP:rs121918002
- M295 (≠ V214) to T: in HOPS; 8.5% of wild-type activity; dbSNP:rs1220125702
- Y297 (≠ L216) to D: in HOPS; 1.3% of wild-type activity
- E298 (≠ P217) to K: in HPPI; does not affect alkaline phosphatase activity; dbSNP:rs121918017
- D306 (≠ S225) binding ; mutation to A: Abolished alkaline phosphatase activity.
- G326 (= G245) to R: in HOPS; in a patient carrying also K-291
- F327 (= F246) to G: in HOPS; requires 2 nucleotide substitutions; to L: in HOPS and HPPI; dbSNP:rs121918010
- G334 (≠ S253) to D: in HOPS; abolished alkaline phosphatase activity; dbSNP:rs121918009; to R: in HOPS; weak alkaline phosphatase activity
- G339 (≠ A258) to R: in HOPS; loss of alkaline phosphatase activity
- D378 (= D298) to V: in HOPS; strongly reduced alkaline phosphatase activity; dbSNP:rs121918008
Sites not aligning to the query:
- 1:17 signal peptide
- 28 Y → C: in HPPI; 7% of activity
- 33 A → V: in HOPS; strongly reduced alkaline phosphatase activity; dbSNP:rs121918005
- 40 A → V: in HOPS; 2% of activity; dbSNP:rs770093969
- 382 V → I: in HOPS; abolished alkaline phosphatase activity; dbSNP:rs771540767
- 391 R → C: in HOPS; moderate; 4-10% of alkaline phosphatase activity; dbSNP:rs371243939; R → H: in HPPC and HOPS; severe allele; loss of alkaline phosphatase activity; dbSNP:rs1442918125
- 406 D → G: in HOPS; 15% of activity
- 411 T → A: in HOPS; absence of residual enzymatic activity
- 414 L → M: in HOPS; loss of alkaline phosphatase activity
- 417 N → S: in HOPS; very low alkaline phosphatase activity; does not affect subcellular location; fails to assemble into dimeric structure; dbSNP:rs121918014
- 420 G → A: in HOPS; very low alkaline phosphatase activity; does not affect subcellular location; G → S: in HOPS; very low alkaline phosphatase activity; does not affect subcellular location
- 423 V → A: in HOPS; 16% alkaline of phosphatase activity
- 426 G → C: in HPPI; partial loss of activity
- 430 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 440 natural variant: Missing (in HOPS; uncertain significance)
- 445 S → P: in HOPS; severe; 2% of activity; dbSNP:rs1553415041
- 450 R → C: in HOPS; severe; 4% of activity; dbSNP:rs138690664
- 452 E → K: in HOPS; loss of alkaline phosphatase activity; dbSNP:rs966212736
- 456 G → R: in HPPI and HOPS; strongly reduced alkaline phosphatase activity; dbSNP:rs121918016
- 459 V → L: in HOPS; loss of alkaline phosphatase activity
- 476 E → A: in HOPS; loss of alkaline phosphatase activity
- 478 N → I: in HOPS; 9% of activity
- 489 C → S: in HOPS; reduces alkaline phosphatase activity
- 490 I → F: in HOPS; odonto; partial loss of activity
- 522 V → A: in dbSNP:rs34605986
7yivA The crystal structure of human tissue nonspecific alkaline phosphatase (alpl) at basic ph (see paper)
29% identity, 55% coverage: 30:299/492 of query aligns to 35:362/484 of 7yivA
- binding calcium ion: E218 (≠ S180), F273 (= F211), D289 (≠ S225)
- binding magnesium ion: D43 (= D38), H154 (= H138), T156 (= T140), E315 (= E251)
- binding zinc ion: D43 (= D38), S93 (= S87), D320 (= D256), H324 (= H260), D361 (= D298), H362 (= H299)
Sites not aligning to the query:
P83456 Alkaline phosphatase; AP; EC 3.1.3.1 from Gadus morhua (Atlantic cod) (see paper)
26% identity, 80% coverage: 27:421/492 of query aligns to 33:467/477 of P83456
- N124 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- C165 (≠ N148) modified: Disulfide link with 185
- C185 (vs. gap) modified: Disulfide link with 165
- N214 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N413 (≠ A358) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Query Sequence
>6936385 FitnessBrowser__SB2B:6936385
MSSKLLALLLLALPLTAAAADPLKTPSKPKNMVIMIGDGMGPAYTSAYRYFKDNPDTEEI
EQTVFDRLLAGMASTYPAPVSGYVTDSAAAATALATGHKSYNGAISVDVNKAPLPTLFEK
AREAGLATGVAVSSQINHATPAAFLAHNESRKNYDEIASAILGSDAQVLLGGGQKYFDES
LLADYRAKGYQHLTDIGALDTISSGKVLGLFAEVQLPWVIDNPESHQLSRLTAKALELLS
QNDKGFVLLVEGSLIDWAGHNNDIVTAMAEMDEFARAIEVVEEFVRTRGDTLMVITADHN
TGGLSIGADDQYLWDAALLRGVKASPDAMAAAIIAGDVWQEQLETQLGFTLESDEQAAIS
RARMQGQDVLSSAIKTMLDKRSYTGWTSGGHTALDVQVFAQGPASGLFIGHQDNTEIAQK
MMSLLPKPKKAAAVVEPTAPSITLPPEAPVSEAPLVNPVVPETAQPQETTQDDAFNPGSD
VSQETEISVTTH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory