Comparing 6938067 FitnessBrowser__SB2B:6938067 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
26% identity, 96% coverage: 16:404/405 of query aligns to 20:421/425 of O59010
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
26% identity, 94% coverage: 16:395/405 of query aligns to 12:402/408 of 6bauA
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
26% identity, 94% coverage: 16:395/405 of query aligns to 12:402/409 of 6bavA
2nwwA Crystal structure of gltph in complex with tboa (see paper)
26% identity, 94% coverage: 16:395/405 of query aligns to 11:401/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
25% identity, 94% coverage: 16:395/405 of query aligns to 20:410/419 of 6x15A
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
25% identity, 94% coverage: 16:395/405 of query aligns to 17:407/413 of 6x14A
Sites not aligning to the query:
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
27% identity, 75% coverage: 16:317/405 of query aligns to 12:322/396 of 6bmiA
Sites not aligning to the query:
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
25% identity, 93% coverage: 16:391/405 of query aligns to 11:395/416 of 6r7rA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
25% identity, 93% coverage: 16:391/405 of query aligns to 15:403/424 of 6zl4A
Sites not aligning to the query:
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
25% identity, 93% coverage: 16:391/405 of query aligns to 18:406/427 of 5e9sA
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
25% identity, 93% coverage: 16:391/405 of query aligns to 16:404/425 of 6zgbA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
25% identity, 93% coverage: 16:391/405 of query aligns to 18:406/426 of 6xwnB
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
25% identity, 94% coverage: 23:404/405 of query aligns to 33:404/412 of 7awmA
7bcsA Asct2 in the presence of the inhibitor lc-bpe (position "down") in the outward-open conformation. (see paper)
29% identity, 61% coverage: 146:392/405 of query aligns to 184:431/442 of 7bcsA
7bcqA Asct2 in the presence of the inhibitor lc-bpe (position "up") in the outward-open conformation. (see paper)
29% identity, 61% coverage: 146:392/405 of query aligns to 184:431/442 of 7bcqA
Sites not aligning to the query:
6mpbB Cryo-em structure of the human neutral amino acid transporter asct2 (see paper)
29% identity, 61% coverage: 146:392/405 of query aligns to 188:435/446 of 6mpbB
Q15758 Neutral amino acid transporter B(0); ATB(0); Baboon M7 virus receptor; RD114/simian type D retrovirus receptor; Sodium-dependent neutral amino acid transporter type 2; Solute carrier family 1 member 5 from Homo sapiens (Human) (see 2 papers)
29% identity, 61% coverage: 146:392/405 of query aligns to 230:477/541 of Q15758
Sites not aligning to the query:
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
25% identity, 64% coverage: 146:405/405 of query aligns to 204:471/503 of Q10901
Sites not aligning to the query:
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
25% identity, 95% coverage: 8:390/405 of query aligns to 2:403/424 of 7xr6A
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
25% identity, 93% coverage: 16:390/405 of query aligns to 4:388/402 of 7vr7A
Sites not aligning to the query:
>6938067 FitnessBrowser__SB2B:6938067
MSTEKSLLANAAGGSLVLQIFVGIIAGVALAGFSPEAANQVAFLGDLFVGALKAIAPVLV
FVLVASSIANQVSGAQTNMRPIILLYLVGTFAAALTAVLMSFAFPTSLVLIDAAAGANPP
EGIGQVLNTLLFKLVDNPVNALINANYIGLLAWGVGLGIALRHASTSTKNMLHDVSHGVS
QLVRFVICLAPIGIFGLVAATIAQTGFEALAAYAQLLGVLLGAMAVIAFVVNPLIVFLKI
RRNPYPLVFKCLRESGVTAFFTRSSAANIPVNMALCERLKLHEDTYSVSIPLGATINMAG
AAITITVLTLAAVHTLGIEVDLATALLLSVIAAVSACGASGVAGGSLLLIPLACSLFGIS
NDIAMQVVAVGFTIGVIQDSAETALNSSTDVLFTAAACEAAERKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory