SitesBLAST
Comparing 6938128 FitnessBrowser__SB2B:6938128 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
26% identity, 79% coverage: 1:243/307 of query aligns to 1:257/322 of 1r6dA
- active site: T127 (≠ S113), N128 (≠ I114), Q129 (≠ K115), Y151 (= Y139), K155 (= K143)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (≠ A71), H88 (= H72), T127 (≠ S113), N128 (≠ I114), Q129 (≠ K115), Y151 (= Y139), N180 (≠ L168), K190 (vs. gap), L191 (vs. gap), P206 (= P190), Y208 (= Y193), R215 (= R200), N250 (≠ T236)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (≠ V12), D37 (≠ I29), S38 (≠ T30), L39 (≠ S31), T40 (≠ R32), A42 (≠ K34), G43 (≠ S35), D63 (= D53), I64 (≠ W54), F83 (≠ L67), A84 (= A68), A85 (≠ S69), S87 (≠ A71), T102 (= T88), V125 (≠ L111), S126 (= S112), Y151 (= Y139), K155 (= K143), N181 (≠ V169)
Sites not aligning to the query:
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
26% identity, 79% coverage: 1:243/307 of query aligns to 1:257/322 of 1r66A
- active site: T127 (≠ S113), D128 (≠ I114), E129 (≠ K115), Y151 (= Y139), K155 (= K143)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (≠ V12), D37 (≠ I29), S38 (≠ T30), L39 (≠ S31), T40 (≠ R32), G43 (≠ S35), D63 (= D53), I64 (≠ W54), F83 (≠ L67), A84 (= A68), A85 (≠ S69), S87 (≠ A71), T102 (= T88), V125 (≠ L111), S126 (= S112), Y151 (= Y139), K155 (= K143), N181 (≠ V169)
- binding thymidine-5'-diphosphate: H88 (= H72), E129 (≠ K115), N180 (≠ L168), K190 (vs. gap), L191 (vs. gap), P206 (= P190), Y208 (= Y193), R215 (= R200), N250 (≠ T236)
Sites not aligning to the query:
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
24% identity, 97% coverage: 1:297/307 of query aligns to 1:289/309 of 4zrnA
- active site: T117 (≠ S113), G119 (≠ K115), A120 (= A116), Y143 (= Y139), K147 (= K143), Y181 (vs. gap), G185 (≠ N177)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ V12), D31 (≠ S31), N32 (≠ R32), S34 (≠ K34), S35 (= S35), G36 (vs. gap), S51 (≠ A47), I52 (= I48), L73 (= L67), A74 (= A68), A75 (≠ S69), T92 (= T88), S115 (≠ L111), S116 (= S112), Y143 (= Y139), K147 (= K143), Y170 (≠ P166), V173 (= V169)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S113), G119 (≠ K115), A120 (= A116), Y143 (= Y139), N172 (≠ L168), G185 (≠ N177), V186 (≠ L178), H201 (≠ F191), F203 (≠ Y193), Y208 (≠ N198), R210 (= R200), V244 (≠ T236), R267 (≠ K270), D270 (= D273)
Q9FX01 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1; At3BETAHSD/D1; 4alpha-carboxysterol-C3-dehydrogenase/C4-decarboxylase isoform 1-1; Reticulon-like protein B24; AtRTNLB24; Sterol-4-alpha-carboxylate 3-dehydrogenase 1, decarboxylating; EC 1.1.1.418 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 58% coverage: 4:181/307 of query aligns to 13:203/439 of Q9FX01
- D41 (≠ S31) Essential for the 3betaHSD/D activity; mutation to V: Lost activity.
- D72 (≠ A47) Essential for the 3betaHSD/D activity; mutation D->A,V: Lost activity.
- T131 (≠ L111) Essential for the 3betaHSD/D activity; mutation to V: Lost activity.
- S133 (= S113) mutation to A: Reduced activity with slower catalysis and lower substrate binding.
- S135 (≠ K115) mutation to A: Normal activity, but slower catalysis with 4alpha-carboxysterol as substrate.; mutation to T: Altered activity due to reduced affinity and catalysis and leading to lower amount of C4-demethylated sterols and higher quantities of 4,4-dimethylated sterol intermediates, and a higher ratio of 4,4-dimethylsterols to 4alpha-methylsterols.; mutation to Y: Altered activity leading to an exclusive production of C4-methylated sterols and 4alpha-carboxy-3beta-hydroxy sterols.
- Y161 (= Y139) Essential for the 3betaHSD/D activity; mutation to F: Lost activity.
- K165 (= K143) Essential for the 3betaHSD/D activity; mutation to I: Lost activity.
Sites not aligning to the query:
- 320 R→I: Normal activity.
- 328 Essential for the 3betaHSD/D activity; R→I: Lost activity.
5u9cA 1.9 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase from yersinia enterocolitica
27% identity, 86% coverage: 2:265/307 of query aligns to 4:251/288 of 5u9cA
Q9LPG6 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2; NDP-rhamnose synthase; Protein MUCILAGE-MODIFIED 4; Protein RHAMNOSE BIOSYNTHESIS 2; Rhamnose biosynthetic enzyme 2; AtRHM2; UDP-L-rhamnose synthase MUM4; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
26% identity, 55% coverage: 3:171/307 of query aligns to 11:193/667 of Q9LPG6
- G18 (= G10) mutation to A: Abolishes dehydratase activity.
- K36 (≠ D26) mutation to A: Reduces dehydratase activity.
- D96 (≠ S74) mutation to N: In mum4-1; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
- K165 (= K143) mutation to A: Abolishes dehydratase activity.
- G193 (= G171) mutation to R: In mum4-2; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
Sites not aligning to the query:
- 392 G→A: No effect on dehydratase activity.
- 413 K→A: No effect on dehydratase activity.
- 518 K→A: No effect on dehydratase activity.
2hunA Crystal structure of hypothetical protein ph0414 from pyrococcus horikoshii ot3
28% identity, 75% coverage: 1:229/307 of query aligns to 2:238/329 of 2hunA
- active site: T125 (≠ S113), D126 (≠ I114), E127 (≠ K115), Y149 (= Y139), K153 (= K143)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (≠ V12), D34 (= D23), K35 (≠ E24), S40 (≠ I29), D60 (= D49), V61 (vs. gap), L80 (= L67), A81 (= A68), A82 (≠ S69), S99 (≠ T88), T125 (≠ S113), K153 (= K143), C176 (≠ P166), T177 (≠ P167), N178 (≠ L168), N179 (≠ V169)
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
25% identity, 79% coverage: 1:243/307 of query aligns to 1:257/313 of 6bwlA
- active site: T122 (≠ S113), C123 (≠ I114), M124 (≠ K115), Y147 (= Y139), K151 (= K143)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ V12), D31 (vs. gap), N32 (vs. gap), L33 (vs. gap), N35 (≠ S31), S36 (≠ R32), D57 (≠ H51), I58 (≠ T52), L79 (= L67), A80 (= A68), A81 (≠ S69), I83 (≠ A71), M120 (≠ L111), K151 (= K143), N176 (≠ L168), T177 (≠ V169)
- binding uridine-5'-diphosphate: N176 (≠ L168), G189 (vs. gap), V190 (vs. gap), N205 (≠ P192), I206 (vs. gap), Y207 (= Y193), Q212 (≠ N198), R214 (= R200), I250 (≠ T236)
Sites not aligning to the query:
H1ZZB0 Aurachin B dehydrogenase; EC 1.1.1.394 from Stigmatella aurantiaca (see paper)
22% identity, 84% coverage: 1:257/307 of query aligns to 1:255/334 of H1ZZB0
- S111 (= S112) mutation to A: Does not produce aurachin B.
- Y139 (= Y139) mutation to F: Does not produce aurachin B.
6kvcA Moee5 in complex with udp-glucose and NAD (see paper)
25% identity, 78% coverage: 3:242/307 of query aligns to 3:240/299 of 6kvcA
- active site: S109 (= S113), S110 (≠ I114), S111 (≠ K115), Y132 (= Y139), K136 (= K143)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ V12), D31 (≠ T30), R32 (≠ S31), R33 (= R32), D46 (vs. gap), L47 (vs. gap), L65 (= L67), A66 (= A68), A67 (= A71), P69 (≠ S73), A107 (≠ L111), S109 (= S113), K136 (= K143), F161 (≠ P166), T163 (≠ L168), V164 (= V169), R170 (≠ K175), M173 (≠ L178)
- binding uridine-5'-diphosphate-glucose: P69 (≠ S73), R72 (≠ N76), S109 (= S113), S110 (≠ I114), Y132 (= Y139), T163 (≠ L168), M173 (≠ L178), F174 (vs. gap), R177 (≠ S180), E189 (≠ P192), I190 (vs. gap), Y191 (= Y193), Q196 (≠ N198), R198 (= R200)
Sites not aligning to the query:
6kv9A Moee5 in complex with udp-glucuronic acid and NAD (see paper)
25% identity, 78% coverage: 3:242/307 of query aligns to 3:241/299 of 6kv9A
- active site: S110 (= S113), S111 (≠ I114), S112 (≠ K115), Y133 (= Y139), K137 (= K143)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ V12), D31 (≠ T30), R32 (≠ S31), R33 (= R32), D47 (≠ I48), L48 (≠ D49), L66 (= L67), A67 (= A68), A68 (= A71), P70 (≠ S73), C85 (≠ T88), A108 (≠ L111), S109 (= S112), K137 (= K143), F162 (≠ P166), T164 (≠ L168), V165 (= V169), R171 (≠ K175), M174 (≠ L178)
- binding uridine-5'-diphosphate-glucuronic acid: P70 (≠ S73), R73 (≠ N76), S110 (= S113), S111 (≠ I114), Y133 (= Y139), T164 (≠ L168), R171 (≠ K175), M174 (≠ L178), F175 (vs. gap), R178 (≠ S180), E190 (≠ P192), I191 (vs. gap), Y192 (= Y193), Q197 (≠ N198), R199 (= R200), V235 (≠ T236)
Sites not aligning to the query:
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
22% identity, 84% coverage: 1:257/307 of query aligns to 1:274/314 of 6zljA
- active site: T126 (≠ S113), S127 (≠ I114), S128 (≠ K115), F149 (≠ Y139), K153 (= K143)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ V12), D32 (≠ T30), H33 (≠ S31), F34 (≠ R32), I35 (≠ C33), K43 (≠ P41), D62 (vs. gap), I63 (vs. gap), L81 (= L67), A82 (= A68), A83 (≠ S69), I124 (≠ L111), T126 (≠ S113), K153 (= K143), Y176 (≠ P166), T178 (≠ L168), V179 (= V169), R185 (≠ K175), M188 (≠ L178)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (≠ A71), R88 (≠ S74), T126 (≠ S113), S127 (≠ I114), S128 (≠ K115), F149 (≠ Y139), F177 (≠ P167), T178 (≠ L168), R185 (≠ K175), M188 (≠ L178), A189 (vs. gap), R192 (≠ S180), T204 (≠ P192), F206 (= F194), Q211 (≠ R199), R213 (= R200), I250 (≠ T236)
Sites not aligning to the query:
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: 276
2pk3A Crystal structure of a gdp-4-keto-6-deoxy-d-mannose reductase (see paper)
29% identity, 52% coverage: 1:160/307 of query aligns to 1:161/309 of 2pk3A
- active site: S114 (= S113), S115 (≠ I114), E116 (≠ K115), Y140 (= Y139), K144 (= K143)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G10 (= G10), F11 (= F11), V12 (= V12), R32 (= R32), D47 (= D49), I48 (vs. gap), L69 (= L67), A70 (= A68), A71 (≠ S69), S73 (≠ A71), I112 (≠ L111), Y140 (= Y139), K144 (= K143)
- binding guanosine-5'-diphosphate-alpha-d-mannose: S73 (≠ A71), V75 (≠ S73), S114 (= S113), S115 (≠ I114), Y140 (= Y139)
Sites not aligning to the query:
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: 170
- binding guanosine-5'-diphosphate-alpha-d-mannose: 168, 169, 178, 179, 180, 183, 184, 203, 204, 209, 244, 267, 269, 272
Q6T1X6 GDP-6-deoxy-D-mannose reductase; EC 1.1.1.281 from Aneurinibacillus thermoaerophilus (see paper)
29% identity, 52% coverage: 1:160/307 of query aligns to 1:161/309 of Q6T1X6
Sites not aligning to the query:
- 169 binding
- 183 binding
- 209 binding
Q9SYM5 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1; Protein REPRESSOR OF LRX1 1; Rhamnose biosynthetic enzyme 1; AtRHM1; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
30% identity, 37% coverage: 59:171/307 of query aligns to 79:191/669 of Q9SYM5
Sites not aligning to the query:
- 283 R→K: In rol1-2; Abolishes dehydratase activity in vitro (PubMed:16766693). Induces aberrant accumulation of flavonols leading to alterations in plant growth and cell shape formation (PubMed:18567791, PubMed:18757557).
Q9R1J0 Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating; EC 1.1.1.170 from Mus musculus (Mouse) (see 3 papers)
29% identity, 49% coverage: 2:152/307 of query aligns to 28:174/362 of Q9R1J0
- V53 (= V27) to D: in bpa; does not rescue the yeast mutant lacking the ortholog erg26
- A94 (= A68) to T: in bpa; does not rescue the yeast mutant lacking the ortholog erg26
- P98 (≠ H72) to L: in str; does not rescue the yeast mutant lacking the ortholog erg26
- V109 (≠ T88) to M: in str; rescues the yeast mutant lacking the ortholog erg26
Sites not aligning to the query:
- 103:362 natural variant: Missing (in bpa)
- 359:362 Prevents secretion from ER
3st7A Crystal structure of capsular polysaccharide assembling protein capf from staphylococcus aureus (see paper)
25% identity, 81% coverage: 1:250/307 of query aligns to 1:219/369 of 3st7A
Sites not aligning to the query:
6dntA Udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid (see paper)
25% identity, 79% coverage: 3:243/307 of query aligns to 6:253/310 of 6dntA
- active site: S120 (= S113), S121 (≠ I114), A122 (≠ K115), Y144 (= Y139), K148 (= K143), A187 (vs. gap)
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: A80 (= A71), S120 (= S113), S121 (≠ I114), Y144 (= Y139), F172 (≠ P167), N173 (≠ L168), A187 (vs. gap), V188 (vs. gap), K191 (vs. gap), V203 (≠ F191), I204 (≠ P192), Y205 (= Y193), Q210 (≠ N198), R212 (= R200), I246 (≠ T236)
- binding nicotinamide-adenine-dinucleotide: G10 (= G7), G13 (= G10), F14 (= F11), I15 (≠ V12), D33 (≠ S31), N34 (≠ R32), L35 (≠ C33), S36 (≠ K34), S37 (= S35), G38 (vs. gap), D57 (= D49), L58 (vs. gap), L76 (= L67), A77 (= A68), A78 (≠ S69), A80 (= A71), S118 (≠ L111), S119 (= S112), Y144 (= Y139), K148 (= K143), Y171 (≠ P166), V174 (= V169)
- binding zinc ion: E209 (≠ S197)
Sites not aligning to the query:
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: 269, 272
- binding zinc ion: 275
3m2pB The crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus
26% identity, 56% coverage: 1:171/307 of query aligns to 2:158/255 of 3m2pB
- active site: A100 (≠ L111), S101 (= S112), T102 (≠ S113), M125 (≠ Y138), Y126 (= Y139), S129 (≠ T142), K130 (= K143)
- binding uridine-5'-diphosphate: G8 (= G7), G11 (= G10), F12 (= F11), L13 (≠ V12), R33 (= R32), A64 (≠ S69), L81 (≠ T86)
6vloA X-ray structure of the r141 sugar 4,6-dehydratase from acanthamoeba polyphaga minivirus (see paper)
27% identity, 56% coverage: 3:173/307 of query aligns to 6:185/319 of 6vloA
- active site: T126 (≠ S113), D127 (≠ I114), E128 (≠ K115), Y151 (= Y139), K155 (= K143)
- binding nicotinamide-adenine-dinucleotide: G10 (= G7), G13 (= G10), F14 (= F11), I15 (≠ V12), D36 (vs. gap), I37 (vs. gap), A42 (vs. gap), D59 (≠ N36), I60 (= I37), F81 (≠ L67), A82 (= A68), A83 (≠ S69), S85 (≠ A71), M124 (≠ L111), T126 (≠ S113), K155 (= K143)
- binding thymidine-5'-diphosphate: N180 (≠ L168)
Sites not aligning to the query:
Query Sequence
>6938128 FitnessBrowser__SB2B:6938128
MKVLITGGSGFVGRYLQGYFNSDEYDVAITSRCKSNISDFPVYTIPAIDQHTDWKHALKN
VDVVVHLASRAHSSDNHSEAAKEDFTKTNVLGLSKLLDDCIFLGVKRIIYLSSIKALGES
TDGRDAFSESDKYNPADYYGITKARAEQLVVEKCKHSGLDYTIIRPPLVYGKSAKANLQS
IARGLSYSLPFPYFTSSNRRSLISVHSLCRFIVAVANDPNTNNQIYNVADNYVLSTKDIF
SLIKSCSNSKSFIFPIPKFIFTFLAFFWSKFGDVSTKLYGSLEINNTKATKVISWKPLEK
PEKNDFV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory