SitesBLAST
Comparing 6938805 FitnessBrowser__SB2B:6938805 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9JI39 ATP-binding cassette sub-family B member 10, mitochondrial; ABC-mitochondrial erythroid protein; ABC-me protein; ATP-binding cassette transporter 10; ABC transporter 10 protein from Mus musculus (Mouse) (see 2 papers)
35% identity, 98% coverage: 5:588/593 of query aligns to 106:698/715 of Q9JI39
- G497 (= G391) mutation to A: Decreases ATP binding about 50%.
- K498 (= K392) mutation to R: Decreases ATP binding about 50%.
- C547 (≠ D441) modified: S-glutathionyl cysteine; mutation to A: Does not affect ABCB10 glutathionylation.
- G602 (= G493) mutation to D: Affects ATP hydrolysis but not binding.; mutation to V: Affects ATP hydrolysis but not binding.
- E624 (= E515) mutation to Q: Affects ATP hydrolysis but not binding.
- C675 (≠ I566) mutation to A: Prevents ABCB10 glutathionylation.
Sites not aligning to the query:
- 1:82 modified: transit peptide, Mitochondrion
7metA A. Baumannii msba in complex with tbt1 decoupler (see paper)
34% identity, 94% coverage: 25:584/593 of query aligns to 7:561/564 of 7metA
4ayxA Structure of the human mitochondrial abc transporter, abcb10 (rod form b) (see paper)
38% identity, 85% coverage: 72:575/593 of query aligns to 56:566/571 of 4ayxA
Sites not aligning to the query:
Q9NRK6 ATP-binding cassette sub-family B member 10, mitochondrial; ABC-mitochondrial erythroid protein; ABC-me protein; ATP-binding cassette transporter 10; ABC transporter 10 protein; Mitochondrial ATP-binding cassette 2; M-ABC2 from Homo sapiens (Human) (see 5 papers)
37% identity, 88% coverage: 72:593/593 of query aligns to 209:738/738 of Q9NRK6
- C215 (≠ L78) mutation to S: Does not affect ATPase activity; when associated with L-224 and G-582. Activated by Zn (II) mesoporphyrin; when associated with L-224 and G-582.
- C224 (vs. gap) mutation to L: Does not affect ATPase activity; when associated withS-215 and G-582. Activated by Zn (II) mesoporphyrin; when associated with S-215 and G-582.
- R471 (≠ A331) to T: in a breast cancer sample; somatic mutation
- K533 (= K392) mutation to E: Increases hemoglobin biosynthetic process.
- D545 (≠ A404) to N: in dbSNP:rs35698797
- C582 (≠ D441) mutation to G: Does not affect ATPase activity; when associated with S-215 and L-224. Activated by Zn (II) mesoporphyrin; when associated with S-215 and L-224.
- S635 (= S491) mutation to R: Does not rescue hemoglobin and heme biosynthetic process.
- Q638 (= Q494) mutation to H: Does not rescue hemoglobin and heme biosynthetic process.
- D658 (= D514) mutation to A: Does not rescue hemoglobin and heme biosynthetic process.
- E659 (= E515) mutation to A: Does not rescue hemoglobin and heme biosynthetic process.
Sites not aligning to the query:
- 150 A → S: in dbSNP:rs4148756
2onjA Structure of the multidrug abc transporter sav1866 from s. Aureus in complex with amp-pnp (see paper)
33% identity, 95% coverage: 25:590/593 of query aligns to 7:578/578 of 2onjA
- binding phosphoaminophosphonic acid-adenylate ester: Y349 (= Y361), I356 (≠ A368), S376 (= S388), G377 (= G389), G378 (≠ A390), G379 (= G391), K380 (= K392), S381 (= S393), T382 (= T394), Q422 (= Q434), K477 (= K489), S479 (= S491), G480 (= G492), E503 (= E515), H534 (= H546)
2hydA Multidrug abc transporter sav1866 (see paper)
33% identity, 95% coverage: 25:590/593 of query aligns to 7:578/578 of 2hydA
5ochE The crystal structure of human abcb8 in an outward-facing state
35% identity, 92% coverage: 49:593/593 of query aligns to 36:575/576 of 5ochE
- binding adenosine-5'-diphosphate: Y341 (vs. gap), C343 (= C360), G370 (= G389), G372 (= G391), K373 (= K392), T374 (≠ S393), T375 (= T394)
- binding cholesterol hemisuccinate: P163 (= P183), F238 (≠ I259), S242 (≠ M263), N243 (≠ F264), F246 (≠ I267), M285 (≠ T305), L288 (≠ I308), V295 (= V315)
Q9NUT2 Mitochondrial potassium channel ATP-binding subunit; ATP-binding cassette sub-family B member 8, mitochondrial; ABCB8; Mitochondrial ATP-binding cassette 1; M-ABC1; Mitochondrial sulfonylurea-receptor; MITOSUR from Homo sapiens (Human) (see 4 papers)
35% identity, 91% coverage: 49:590/593 of query aligns to 167:712/735 of Q9NUT2
- 507:514 (vs. 386:393, 63% identical) binding
- GK 512:513 (= GK 391:392) mutation to AR: Renders the protein unstable.
- K513 (= K392) mutation to A: Abolish binding to ATP.
- A690 (≠ Q568) to G: in a breast cancer sample; somatic mutation
Sites not aligning to the query:
- 152 V → I: in dbSNP:rs4148844
- 165 I → T: in a breast cancer sample; somatic mutation
Q0WML0 ABC transporter B family member 27; ABC transporter ABCB.27; AtABCB27; Aluminum tolerance-related ATP-binding cassette transporter; Antigen peptide transporter-like 2; Transporter associated with antigen processing-like protein 2; AtTAP2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 95% coverage: 28:589/593 of query aligns to 65:635/644 of Q0WML0
- E261 (= E216) mutation to K: In als1-1; loss of aluminum tolerance.
7y48B Cryo-em structure of biliverdin-bound mitochondrial abc transporter abcb10 from biortus
37% identity, 85% coverage: 72:575/593 of query aligns to 55:562/567 of 7y48B
O06967 Multidrug resistance ABC transporter ATP-binding/permease protein BmrA; EC 7.6.2.- from Bacillus subtilis (strain 168) (see 2 papers)
35% identity, 95% coverage: 32:593/593 of query aligns to 35:582/589 of O06967
- K380 (= K392) mutation to A: Complete loss of ATPase activity.; mutation to R: Retains 2% ATPase activity; unable to transport Hoechst 33342. Traps ADP in a beryllium fluoride-dependent manner, confirming ATPase activity. Probably unable to undergo NBD dimerization.
- E504 (= E515) mutation E->A,C,D,Q,S: Complete loss of ATPase activity; mutant proteins trap ATP in a vanadate-independent manner whereas the wild-type protein traps ADP.
4aywA Structure of the human mitochondrial abc transporter, abcb10 (plate form) (see paper)
36% identity, 85% coverage: 72:573/593 of query aligns to 56:560/560 of 4aywA
Sites not aligning to the query:
7t55A Cryo-em structure of pcat1 in the inward-facing wide conformation under atp turnover condition (see paper)
33% identity, 94% coverage: 18:575/593 of query aligns to 146:701/715 of 7t55A
Sites not aligning to the query:
- binding : 14, 46, 47, 48, 52, 63, 64, 65, 66, 75, 83, 91, 93
7ow8A Cryoem structure of the abc transporter bmra e504a mutant in complex with atp-mg (see paper)
35% identity, 95% coverage: 32:593/593 of query aligns to 26:573/577 of 7ow8A
- binding adenosine-5'-triphosphate: D107 (≠ A124), Y341 (= Y361), S367 (= S388), G368 (= G389), G370 (= G391), K371 (= K392), T372 (≠ S393), T373 (= T394), Q413 (= Q434), I468 (≠ V488), S471 (= S491), G473 (= G493), H526 (= H546)
- binding magnesium ion: T372 (≠ S393), Q413 (= Q434)
7ph2A Nanodisc reconstituted msba in complex with nanobodies, spin-labeled at position a60c (see paper)
30% identity, 95% coverage: 29:589/593 of query aligns to 11:569/569 of 7ph2A
- binding (2~{R},4~{R},5~{R},6~{R})-6-[(1~{R})-1,2-bis(oxidanyl)ethyl]-4-[(2~{R},3~{S},4~{S},5~{R},6~{R})-6-[(1~{S})-1,2-bis(oxidanyl)ethyl]-4-[(2~{R},3~{S},4~{S},5~{S},6~{R})-6-[(1~{S})-1,2-bis(oxidanyl)ethyl]-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-3,5-bis(oxidanyl)oxan-2-yl]oxy-2-[[(2~{R},3~{S},4~{R},5~{R},6~{R})-4-[(3~{R})-3-nonanoyloxytetradecanoyl]oxy-5-[[(3~{R})-3-octanoyloxytetradecanoyl]amino]-6-[[(2~{R},3~{S},4~{S},5~{S},6~{R})-3-oxidanyl-5-[[(3~{R})-3-oxidanylnonanoyl]amino]-4-[(3~{R})-3-oxidanyltetradecanoyl]oxy-6-phosphonooxy-oxan-2-yl]methoxy]-3-phosphonooxy-oxan-2-yl]methoxy]-5-oxidanyl-oxane-2-carboxylic acid: D30 (≠ W48), L37 (≠ V55), F277 (≠ L295), A282 (≠ L300), R285 (≠ G303)
8dmmA Structure of the vanadate-trapped msba bound to kdl (see paper)
30% identity, 95% coverage: 29:589/593 of query aligns to 18:576/576 of 8dmmA
- binding adp orthovanadate: Y347 (= Y361), R350 (≠ T364), S374 (= S388), G375 (= G389), S376 (≠ A390), G377 (= G391), K378 (= K392), S379 (= S393), T380 (= T394), Q420 (= Q434), L476 (≠ K489), S478 (= S491), G479 (= G492), G480 (= G493), H533 (= H546)
- binding (2~{R},4~{R},5~{R},6~{R})-6-[(1~{R})-1,2-bis(oxidanyl)ethyl]-2-[(2~{R},4~{R},5~{R},6~{R})-6-[(1~{R})-1,2-bis(oxidanyl)ethyl]-2-carboxy-2-[[(2~{R},3~{S},4~{R},5~{R},6~{R})-5-[[(3~{R})-3-dodecanoyloxytetradecanoyl]amino]-6-[[(2~{R},3~{S},4~{R},5~{R},6~{R})-3-oxidanyl-5-[[(3~{R})-3-oxidanyltetradecanoyl]amino]-4-[(3~{R})-3-oxidanyltetradecanoyl]oxy-6-phosphonooxy-oxan-2-yl]methoxy]-3-phosphonooxy-4-[(3~{R})-3-tetradecanoyloxytetradecanoyl]oxy-oxan-2-yl]methoxy]-5-oxidanyl-oxan-4-yl]oxy-4,5-bis(oxidanyl)oxane-2-carboxylic acid: V25 (≠ T36), Y79 (≠ F90), Y83 (= Y94), R184 (≠ K195), R234 (≠ L245), K239 (≠ R250), I246 (≠ L257), I250 (≠ G261)
7bcwA Structure of msba in salipro with adp vanadate (see paper)
30% identity, 94% coverage: 29:588/593 of query aligns to 17:574/574 of 7bcwA
- binding adenosine-5'-diphosphate: Y346 (= Y361), G374 (= G389), S375 (≠ A390), K377 (= K392), S378 (= S393), T379 (= T394), L475 (≠ K489), S477 (= S491), Q480 (= Q494)
- binding magnesium ion: S378 (= S393), Q419 (= Q434)
- binding vanadate ion: S373 (= S388), K377 (= K392), S477 (= S491), A505 (= A519), H532 (= H546)
7ph3A Amp-pnp bound nanodisc reconstituted msba with nanobodies, spin- labeled at position a60c (see paper)
30% identity, 94% coverage: 29:588/593 of query aligns to 20:577/577 of 7ph3A
- binding phosphoaminophosphonic acid-adenylate ester: Y349 (= Y361), S376 (= S388), G377 (= G389), G379 (= G391), K380 (= K392), S381 (= S393), T382 (= T394), Q422 (= Q434), L478 (≠ K489), S480 (= S491), G482 (= G493), Q483 (= Q494), H535 (= H546)
- binding magnesium ion: S381 (= S393), Q422 (= Q434)
4s0fA Crystal structure of the peptidase-containing abc transporter pcat1 e648q mutant complexed with atpgs in an occluded conformation (see paper)
33% identity, 93% coverage: 26:575/593 of query aligns to 4:551/565 of 4s0fA
6bppA E. Coli msba in complex with lps and inhibitor g092 (see paper)
30% identity, 94% coverage: 29:588/593 of query aligns to 19:576/576 of 6bppA
- binding (2E)-3-{6-[(1S)-1-(3-amino-2,6-dichlorophenyl)ethoxy]-4-cyclopropylquinolin-3-yl}prop-2-enoic acid: L168 (≠ V178), A172 (≠ V182), V175 (= V185), S176 (≠ L186), I179 (= I189), A256 (≠ T266), M288 (≠ A298), L291 (≠ V301), M292 (≠ A302), K296 (≠ A306)
Query Sequence
>6938805 FitnessBrowser__SB2B:6938805
MPDTLATNNQATTASQGNVVAWLGSFLRPYKLRVITALICLLIGSLAWLALGQGVKLIVD
EGFVAGDAARLNQLVWLLVGIAAISSSAVFCRFYLMSWLGERVSNDIRARVYDNLLTLPP
AFYAKLRTGEVISRFTADSTLLQTVIGSSFSMALRSFVSVLGGIAMMAITSVKLTALVLV
AVPAVLVPILIFGRKVRTLSRDSQDRVADLGAYIDESLHEIHTVQSYTHEQVDRDKFAGL
LGKVLGSAGRRIQFRALLIAGVMFLTIAAIALMIWVGARDVMIGAISAGELSAFLFYALL
VAGATATISEVIGDVQRASGAAERLKELSEAVSEVPQARHPVALPAKLSGDIRIEGLSFC
YPGTDVRALDEISVHIRPGEKVALVGESGAGKSTLFQLLGRFYAPDSGTIYLDDTDIANA
DLQALRRAFALVPQESVIFADSVLENVRYGKVDATLDEVKAACVAARAHDFIEAMPEGYH
SYLGERGVKLSGGQKQRIAIARAILASRPVLLLDEATSALDAVSERYVKEALDTLICGRT
SLIIAHRLATVINADRILVMDKGKIIAQGSHTELLESSQQYREFASLQLLTEA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory