SitesBLAST
Comparing 6938941 FitnessBrowser__SB2B:6938941 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5mh6A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-ketohexanoic acid and NAD+ (1.35 a resolution)
31% identity, 83% coverage: 47:302/308 of query aligns to 41:305/306 of 5mh6A
- binding 2-Ketohexanoic acid: R64 (≠ F67), A65 (= A68), G66 (= G69), H89 (≠ F91), R224 (= R223), H272 (= H271), Y280 (≠ F277)
- binding magnesium ion: T130 (= T129), A132 (≠ Q131), F210 (≠ L209), E211 (≠ A210), M213 (= M212), G225 (= G224), P226 (≠ D225), V228 (≠ L227), E230 (≠ L229), D241 (≠ P240), S251 (≠ N250)
- binding nicotinamide-adenine-dinucleotide: A65 (= A68), G66 (= G69), T86 (≠ R88), H89 (≠ F91), G142 (= G141), T143 (≠ S142), L144 (≠ I143), R164 (= R163), P196 (= P195), T201 (= T200), V222 (≠ L221), A223 (≠ G222), R224 (= R223), H272 (= H271), S274 (≠ A273)
5mhaB D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
31% identity, 83% coverage: 47:302/308 of query aligns to 43:307/308 of 5mhaB
- binding 2-Ketohexanoic acid: R66 (≠ F67), R226 (= R223), H274 (= H271), Y282 (≠ F277)
- binding (2R)-2-hydroxyhexanoic acid: R66 (≠ F67), A67 (= A68), G68 (= G69), H91 (≠ F91), Y282 (≠ F277)
- binding magnesium ion: F212 (≠ L209), E213 (≠ A210), M215 (= M212), D243 (≠ P240)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A67 (= A68), G68 (= G69), T88 (≠ R88), L143 (≠ T140), G144 (= G141), T145 (≠ S142), L146 (≠ I143), R165 (≠ N162), R166 (= R163), S167 (= S164), P180 (≠ L177), T197 (≠ L194), P198 (= P195), T203 (= T200), V224 (≠ L221), A225 (≠ G222), R226 (= R223), H274 (= H271), S276 (≠ A273)
5mhaA D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
31% identity, 83% coverage: 47:302/308 of query aligns to 43:307/308 of 5mhaA
- binding 2-Ketohexanoic acid: R66 (≠ F67), A67 (= A68), G68 (= G69), H91 (≠ F91), R226 (= R223), H274 (= H271), Y282 (≠ F277)
- binding magnesium ion: T132 (= T129), A134 (≠ Q131)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A67 (= A68), G68 (= G69), T88 (≠ R88), L143 (≠ T140), G144 (= G141), T145 (≠ S142), L146 (≠ I143), R165 (≠ N162), R166 (= R163), S167 (= S164), P180 (≠ L177), T197 (≠ L194), P198 (= P195), T203 (= T200), V224 (≠ L221), A225 (≠ G222), R226 (= R223), H274 (= H271), S276 (≠ A273)
5mh5A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-keto-hexanoic acid and NADP+ (1.4 a resolution)
31% identity, 83% coverage: 47:302/308 of query aligns to 43:307/308 of 5mh5A
- binding 2-Ketohexanoic acid: R66 (≠ F67), A67 (= A68), G68 (= G69), H91 (≠ F91), R226 (= R223), H274 (= H271), Y282 (≠ F277)
- binding magnesium ion: T132 (= T129), A134 (≠ Q131), F212 (≠ L209), E213 (≠ A210), M215 (= M212), D243 (≠ P240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A67 (= A68), G68 (= G69), T88 (≠ R88), G142 (= G139), L143 (≠ T140), G144 (= G141), T145 (≠ S142), L146 (≠ I143), R165 (≠ N162), R166 (= R163), S167 (= S164), T197 (≠ L194), P198 (= P195), T203 (= T200), V224 (≠ L221), A225 (≠ G222), R226 (= R223), H274 (= H271), S276 (≠ A273)
5vg6B Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with NADPH and mes.
31% identity, 91% coverage: 30:308/308 of query aligns to 40:315/315 of 5vg6B
- active site: M98 (≠ F91), R230 (= R223), D254 (= D247), E259 (= E252), H278 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A74 (= A68), R92 (≠ N86), M102 (= M95), L147 (≠ T140), G148 (= G141), D149 (≠ S142), L150 (≠ I143), W168 (≠ I161), S169 (≠ N162), R170 (= R163), T171 (≠ S164), K173 (= K166), L201 (= L194), P202 (= P195), T207 (= T200), V228 (≠ L221), R230 (= R223), H278 (= H271), A280 (= A273), S281 (≠ A274), Y315 (= Y308)
7jqiA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with alpha-ketoglutarate and NADP+
30% identity, 78% coverage: 68:308/308 of query aligns to 65:312/312 of 7jqiA
- binding 2-oxoglutaric acid: A65 (= A68), G66 (= G69), R227 (= R223), H275 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A68), R89 (vs. gap), M99 (= M95), A144 (≠ T140), G145 (= G141), V146 (≠ S142), L147 (≠ I143), W165 (≠ I161), S166 (≠ N162), R167 (= R163), T168 (≠ S164), K170 (= K166), L198 (= L194), P199 (= P195), L225 (= L221), R227 (= R223), H275 (= H271), A278 (= A274), Y312 (= Y308)
Sites not aligning to the query:
6p35A 2.5 angstrom structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with 2-keto arginine and NADP
30% identity, 78% coverage: 68:308/308 of query aligns to 65:312/312 of 6p35A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A68), R89 (vs. gap), M99 (= M95), A144 (≠ T140), G145 (= G141), V146 (≠ S142), L147 (≠ I143), W165 (≠ I161), S166 (≠ N162), R167 (= R163), T168 (≠ S164), K170 (= K166), L198 (= L194), P199 (= P195), L225 (= L221), R227 (= R223), H275 (= H271), A277 (= A273), A278 (= A274), Y312 (= Y308)
- binding 5-[(diaminomethylidene)amino]-2-oxopentanoic acid: A65 (= A68), R227 (= R223), H275 (= H271), T280 (≠ S276)
Sites not aligning to the query:
7jqhA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with phosphate and NADP+
30% identity, 78% coverage: 68:308/308 of query aligns to 66:313/313 of 7jqhA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A66 (= A68), R90 (vs. gap), M100 (= M95), A145 (≠ T140), G146 (= G141), V147 (≠ S142), L148 (≠ I143), W166 (≠ I161), S167 (≠ N162), R168 (= R163), T169 (≠ S164), K171 (= K166), L199 (= L194), P200 (= P195), L226 (= L221), A227 (≠ G222), R228 (= R223), D252 (= D247), H276 (= H271), A279 (= A274), Y313 (= Y308)
4zqbB Crystal structure of NADP-dependent dehydrogenase from rhodobactersphaeroides in complex with NADP and sulfate
31% identity, 81% coverage: 60:308/308 of query aligns to 67:316/316 of 4zqbB
- active site: L99 (vs. gap), R231 (= R223), E260 (= E252), H279 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R93 (≠ G89), M103 (= M95), G147 (= G139), L148 (≠ T140), G149 (= G141), E150 (≠ S142), L151 (≠ I143), W169 (≠ I161), S170 (≠ N162), R171 (= R163), S172 (= S164), K174 (= K166), L202 (= L194), P203 (= P195), F229 (≠ L221), R231 (= R223), H279 (= H271), S281 (≠ A273), A282 (= A274), Y316 (= Y308)
3kboA 2.14 angstrom crystal structure of putative oxidoreductase (ycdw) from salmonella typhimurium in complex with NADP
28% identity, 94% coverage: 19:308/308 of query aligns to 23:312/312 of 3kboA
- active site: M95 (vs. gap), R227 (= R223), E256 (= E252), H275 (= H271)
- binding N-(2-hydroxyethyl)-N,N-dimethyl-3-sulfopropan-1-aminium: N36 (≠ D32), A53 (≠ S58), R55 (≠ L60), R56 (= R61)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (vs. gap), M99 (= M95), G143 (= G139), A144 (≠ T140), G145 (= G141), V146 (≠ S142), L147 (≠ I143), W165 (≠ I161), S166 (≠ N162), R167 (= R163), S168 (= S164), K170 (= K166), L197 (≠ I193), P199 (= P195), L225 (= L221), A226 (≠ G222), R227 (= R223), D251 (= D247), H275 (= H271), A278 (= A274), Y312 (= Y308)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
30% identity, 81% coverage: 56:305/308 of query aligns to 64:324/334 of 5aovA
- active site: L100 (≠ F91), R241 (= R223), D265 (= D247), E270 (= E252), H288 (= H271)
- binding glyoxylic acid: Y74 (≠ T66), A75 (≠ F67), V76 (≠ A68), G77 (= G69), R241 (= R223), H288 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ A68), T104 (≠ M95), F158 (≠ T140), G159 (= G141), R160 (≠ S142), I161 (= I143), S180 (≠ N162), R181 (= R163), A211 (≠ I193), V212 (≠ L194), P213 (= P195), T218 (= T200), I239 (≠ L221), A240 (≠ G222), R241 (= R223), H288 (= H271), G290 (≠ A273)
Sites not aligning to the query:
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
35% identity, 60% coverage: 122:305/308 of query aligns to 137:323/332 of 6biiA
- active site: R240 (= R223), D264 (= D247), E269 (= E252), H287 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G156 (= G139), F157 (≠ T140), G158 (= G141), R159 (≠ S142), I160 (= I143), A179 (≠ N162), R180 (= R163), S181 (= S164), K183 (= K166), V211 (≠ L194), P212 (= P195), E216 (≠ A199), T217 (= T200), V238 (≠ L221), A239 (≠ G222), R240 (= R223), D264 (= D247), H287 (= H271), G289 (≠ A273)
Sites not aligning to the query:
4z0pA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
30% identity, 89% coverage: 35:308/308 of query aligns to 42:316/316 of 4z0pA
- active site: L95 (≠ F91), R231 (= R223), G250 (≠ Q242), D255 (= D247), E260 (= E252), H279 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (≠ T85), M99 (= M95), M144 (≠ T140), G145 (= G141), V146 (≠ S142), L147 (≠ I143), W165 (≠ I161), S166 (≠ N162), R167 (= R163), S168 (= S164), R170 (≠ K166), L197 (= L194), P198 (= P195), A229 (≠ L221), G230 (= G222), R231 (= R223), H279 (= H271), A281 (= A273), A282 (= A274), Y316 (= Y308)
- binding oxalic acid: W50 (= W43), G70 (≠ F67), A71 (= A68), G72 (= G69), H114 (= H110), R115 (≠ D111), R231 (= R223), H279 (= H271)
4weqA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADP and sulfate (see paper)
30% identity, 89% coverage: 35:308/308 of query aligns to 42:316/316 of 4weqA
- active site: L95 (≠ F91), R231 (= R223), G250 (≠ Q242), D255 (= D247), E260 (= E252), H279 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R89 (≠ T85), M99 (= M95), M144 (≠ T140), G145 (= G141), V146 (≠ S142), L147 (≠ I143), W165 (≠ I161), S166 (≠ N162), R167 (= R163), S168 (= S164), R170 (≠ K166), L197 (= L194), P198 (= P195), A229 (≠ L221), G230 (= G222), R231 (= R223), D255 (= D247), H279 (= H271), A281 (= A273), Y316 (= Y308)
6p2iA Acyclic imino acid reductase (bsp5) in complex with NADPH and d-arg (see paper)
29% identity, 77% coverage: 40:277/308 of query aligns to 45:280/307 of 6p2iA
- binding d-arginine: E51 (= E46), T73 (≠ F67), T74 (≠ A68), S75 (≠ G69), Y97 (≠ I90), W277 (≠ A274)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S98 (≠ F91), V102 (≠ M95), G149 (= G139), I150 (≠ T140), G151 (= G141), Q152 (≠ S142), I153 (= I143), N172 (= N162), K173 (≠ R163), S174 (= S164), R176 (≠ K166), H199 (≠ I193), I200 (≠ L194), P201 (= P195), T206 (= T200), T227 (≠ L221), C228 (≠ G222), W277 (≠ A274)
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
34% identity, 51% coverage: 119:276/308 of query aligns to 138:294/324 of 2gcgA
- active site: R241 (= R223), D265 (= D247), E270 (= E252), H289 (= H271)
- binding (2r)-2,3-dihydroxypropanoic acid: R241 (= R223), H289 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G156 (= G139), G158 (= G141), I160 (= I143), G180 (≠ N162), R181 (= R163), R184 (≠ K166), C212 (≠ L194), S213 (≠ P195), T218 (= T200), I239 (≠ L221), R241 (= R223), D265 (= D247), H289 (= H271), G291 (≠ A273)
Sites not aligning to the query:
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
34% identity, 51% coverage: 119:276/308 of query aligns to 142:298/328 of Q9UBQ7
Sites not aligning to the query:
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
26% identity, 78% coverage: 40:280/308 of query aligns to 44:287/304 of 1wwkA
- active site: S96 (≠ F91), R230 (= R223), D254 (= D247), E259 (= E252), H278 (= H271)
- binding nicotinamide-adenine-dinucleotide: V100 (≠ M95), G146 (= G139), F147 (≠ T140), G148 (= G141), R149 (≠ S142), I150 (= I143), Y168 (≠ I161), D169 (≠ N162), P170 (≠ R163), V201 (≠ L194), P202 (= P195), T207 (= T200), T228 (≠ L221), S229 (≠ G222), D254 (= D247), H278 (= H271), G280 (≠ A273)
5bqfA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADP, hepes and l(+)-tartaric acid
27% identity, 84% coverage: 51:308/308 of query aligns to 55:317/317 of 5bqfA
- active site: E261 (= E252), H280 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A72 (= A68), R90 (≠ T85), M100 (= M95), G144 (= G139), L145 (≠ T140), G146 (= G141), I147 (≠ S142), L148 (≠ I143), W166 (≠ I161), S167 (≠ N162), R168 (= R163), T169 (≠ S164), L198 (= L194), P199 (= P195), A230 (≠ L221), G231 (= G222), R232 (= R223), H280 (= H271), A283 (= A274), Y317 (= Y308)
4xcvA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH
27% identity, 84% coverage: 51:308/308 of query aligns to 55:317/317 of 4xcvA
- active site: E261 (= E252), H280 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A72 (= A68), R90 (≠ T85), M100 (= M95), G144 (= G139), L145 (≠ T140), G146 (= G141), I147 (≠ S142), L148 (≠ I143), W166 (≠ I161), S167 (≠ N162), R168 (= R163), T169 (≠ S164), K171 (= K166), L198 (= L194), P199 (= P195), A230 (≠ L221), G231 (= G222), R232 (= R223), H280 (= H271), A283 (= A274), Y317 (= Y308)
Query Sequence
>6938941 FitnessBrowser__SB2B:6938941
MRHKLLLLTRENERYRSLLASCHLPELELLDDNPANIRLADIWLAEPGLAAPLVNHASGL
RWMQSTFAGVDLLVKPRQRRDYLLTNVRGIFGPLMSEYLFGYLLARQREHDLYKSQQQQK
LWLPGSYKTLQGSELLLLGTGSIAKHLAQTAKHFGMKVAGINRSAKATEGFDEVATLEAL
PTLMARADAIASILPSTEATRGILNENILARMKPDAVLFNLGRGDVLDLDALERQLRQHP
QQQAVLDVFNQEPLPEDHPIWGLGNVIVTPHIAAPSFPEQVAEIFSSNYHKFLLGETLSH
RVNFERGY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory