Comparing 6939142 FitnessBrowser__SB2B:6939142 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P0AGC0 Hexose-6-phosphate:phosphate antiporter from Escherichia coli (strain K12) (see paper)
26% identity, 87% coverage: 5:389/445 of query aligns to 4:397/463 of P0AGC0
Sites not aligning to the query:
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
23% identity, 60% coverage: 44:309/445 of query aligns to 29:301/430 of P0AA76
Sites not aligning to the query:
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
22% identity, 60% coverage: 44:309/445 of query aligns to 18:282/409 of 6e9nA
Sites not aligning to the query:
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
23% identity, 69% coverage: 136:442/445 of query aligns to 126:440/452 of Q5EXK5
Sites not aligning to the query:
>6939142 FitnessBrowser__SB2B:6939142
MLDFFKTRPDQPLIEGTPEKIRSIYKKYQWQVFLGLVLGYAMFYVARMSLNVAKKPMLDA
GIVTLDELGIIGSAFFLTYAVGKFSNGFLSDYANIGRFMSVSLGLSAITCLFMGMNTATF
FFILLWAMNGWFQSVGSAPSCVSIFQWFSPKQRGSVYSIWGGSRNIGEGITWILTATVVS
FFGWRAGFVGAGIATFAAAIAMYFVLKDRPQTYGLPEPAVAYGEDAEIKKKVDPKEIRRA
QLFILKQPTVWIIALACAAMYISRYAMSSWAVLYLQEEKGYSLIDAGFAMSAYPIAGFAG
AILAGIISDKVFNANRHIPTLLYGLANIAGLCLMFWGPQSRVMDAVALGLIGYAIGGLVV
FLAGLTACDLMPKTAVGAVKGFIGLCSYIAASAQEIVSASLIKIHEVDGVKHYDFSTAQY
FWLAAAVVSMFLAMSVWNAKKVVDY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory