SitesBLAST
Comparing 6939481 FitnessBrowser__SB2B:6939481 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P55339 ABC-type transporter ATP-binding protein EcsA from Bacillus subtilis (strain 168) (see paper)
30% identity, 76% coverage: 11:227/284 of query aligns to 3:223/247 of P55339
- G164 (≠ S167) mutation to E: In ecsA-26; exoamylase and other exoenzymes decrease, competence- and sporulation-deficient phenotype.
7o12B Abc transporter nosdfy, amppnp-bound in gdn (see paper)
35% identity, 76% coverage: 12:226/284 of query aligns to 3:215/298 of 7o12B
7o17B Abc transporter nosdfy e154q, atp-bound in lipid nanodisc (see paper)
34% identity, 76% coverage: 12:226/284 of query aligns to 3:215/298 of 7o17B
- binding adenosine-5'-triphosphate: Y12 (≠ F21), V17 (≠ A26), N37 (= N46), G38 (= G47), A39 (= A48), G40 (= G49), K41 (= K50), T42 (≠ S51), T43 (= T52), E80 (≠ Q91), R123 (vs. gap), T127 (≠ R137), S129 (= S139), K130 (≠ V140), G131 (= G141), M132 (≠ Q142)
- binding magnesium ion: K41 (= K50), T42 (≠ S51)
O65934 ABC transporter ATP-binding/permease protein Rv1747; EC 7.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
34% identity, 71% coverage: 12:214/284 of query aligns to 319:528/865 of O65934
- E479 (= E163) mutation to Q: Loss of ATPase activity.
Sites not aligning to the query:
- 33 R→A: Strong decrease in phosphorylation.
- 47 S→A: Strong decrease in phosphorylation. Lack of interaction with PknF. Attenuates growth in macrophages.
- 69 N→A: Strong decrease in phosphorylation.
- 152 modified: Phosphothreonine; T→A: Lack of phosphorylation. Attenuates growth in macrophages and in mice; when associated with A-210.
- 210 modified: Phosphothreonine; T→A: Lack of phosphorylation. Attenuates growth in macrophages and in mice; when associated with A-152.
- 234 R→A: Strong decrease in phosphorylation.
- 248 S→A: Strong decrease in phosphorylation. Decreases interaction with PknF.
- 270 N→A: Strong decrease in phosphorylation.
6xjhC Pmtcd abc exporter without the basket domain at c2 symmetry (see paper)
26% identity, 73% coverage: 12:217/284 of query aligns to 1:199/219 of 6xjhC
- binding phosphothiophosphoric acid-adenylate ester: Y10 (≠ F21), V15 (≠ A26), N35 (= N46), G36 (= G47), G38 (= G49), K39 (= K50), T40 (≠ S51), T41 (= T52), K115 (≠ A133), K119 (≠ R137), S121 (= S139)
- binding magnesium ion: T40 (≠ S51), E70 (≠ Q91)
6xjiC Pmtcd abc exporter at c1 symmetry (see paper)
26% identity, 73% coverage: 12:217/284 of query aligns to 1:199/290 of 6xjiC
- binding phosphothiophosphoric acid-adenylate ester: Y10 (≠ F21), V15 (≠ A26), N35 (= N46), G36 (= G47), G38 (= G49), K39 (= K50), T40 (≠ S51), T41 (= T52), K115 (≠ A133), K119 (≠ R137), S121 (= S139)
- binding magnesium ion: T40 (≠ S51), E70 (≠ Q91)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 76% coverage: 11:227/284 of query aligns to 1:227/343 of P30750
- 40:46 (vs. 46:52, 86% identical) binding
- E166 (= E163) mutation to Q: Exhibits little ATPase activity.
Sites not aligning to the query:
- 278:283 binding
- 295 N→A: Reduces the binding of L-methionine to undetectable levels.
- 295:296 binding
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 74% coverage: 11:221/284 of query aligns to 3:221/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 74% coverage: 11:221/284 of query aligns to 3:221/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 74% coverage: 11:221/284 of query aligns to 3:221/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 74% coverage: 11:221/284 of query aligns to 3:221/242 of 2oljA
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
26% identity, 82% coverage: 11:244/284 of query aligns to 4:246/501 of P04983
- K43 (= K50) mutation to R: Loss of transport.
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 76% coverage: 11:227/284 of query aligns to 2:228/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 76% coverage: 11:227/284 of query aligns to 2:228/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 76% coverage: 11:227/284 of query aligns to 2:228/344 of 6cvlD
- binding phosphothiophosphoric acid-adenylate ester: F12 (= F21), Q14 (vs. gap), I19 (vs. gap), S41 (≠ N46), G42 (= G47), A43 (= A48), G44 (= G49), K45 (= K50), S46 (= S51), T47 (= T52), N141 (≠ R137), S143 (= S139), Q146 (= Q142), H200 (= H196)
Q5SSE9 ATP-binding cassette sub-family A member 13; EC 7.6.2.- from Mus musculus (Mouse) (see paper)
28% identity, 75% coverage: 4:216/284 of query aligns to 3802:4020/5034 of Q5SSE9
- K3849 (= K50) mutation to M: Does not affect intracellular vesicle localization. Affects cholesterol internalization.
- T3999 (≠ S195) mutation to A: Does not affect protein expression. Affects intracellular vesicles localization. Impairs intracellular cholesterol accumulation in the vesicle.
Sites not aligning to the query:
- 3577 H→P: Does not affect protein expression. Decreases intracellular cholesterol accumulation in the vesicle.
- 4735 K→M: Does not affect intracellular vesicle localization.Affects cholesterol internalization.
- 4818 R→C: Does not affect protein expression. Decreases intracellular cholesterol accumulation in the vesicle.
P41233 Phospholipid-transporting ATPase ABCA1; ATP-binding cassette sub-family A member 1; ATP-binding cassette transporter 1; ABC-1; ATP-binding cassette 1; EC 7.6.2.1 from Mus musculus (Mouse) (see paper)
27% identity, 74% coverage: 12:220/284 of query aligns to 899:1113/2261 of P41233
Sites not aligning to the query:
- 489 modified: carbohydrate, N-linked (GlcNAc...) asparagine
O95477 Phospholipid-transporting ATPase ABCA1; ATP-binding cassette sub-family A member 1; ATP-binding cassette transporter 1; ABC-1; ATP-binding cassette 1; Cholesterol efflux regulatory protein; EC 7.6.2.1 from Homo sapiens (Human) (see 35 papers)
27% identity, 74% coverage: 12:220/284 of query aligns to 899:1113/2261 of O95477
- D917 (≠ N28) to Y: in a colorectal cancer sample; somatic mutation
- T929 (≠ V40) to I: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; loss protein subcellular localization to the plasma membrane
- N935 (= N46) to S: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; dbSNP:rs28937313
- K939 (= K50) mutation to M: Inhibits ATPase activity; when associated with M-1952. Decreases translocase activity; when associated with M-1952. Does not affect protein subcellular localization in plasma membrane and endosome; when associated with M-1952.
- S1042 (≠ A147) modified: Phosphoserine; by PKA
- P1065 (= P170) natural variant: P -> S
- M1091 (≠ T198) to T: in FHA1; loss of localization to plasma membrane; decreased cholesterol efflux; decreased phospholipid efflux
- C1110 (≠ L217) modified: S-palmitoyl cysteine; mutation to S: Decreased palmitoylation; when associated with S-3, S-23 and S-1111.
- C1111 (≠ I218) modified: S-palmitoyl cysteine; mutation to S: Decreased palmitoylation; when associated with S-3, S-23 and S-1110.
Sites not aligning to the query:
- 3 modified: S-palmitoyl cysteine; C→S: Mild decrease of palmitoylation. Loss of localization to plasma membrane. Decreased cholesterol efflux. Decreased phospholipid efflux. Decreased palmitoylation; when associated with S-23, S-1110 and S-1111.
- 23 modified: S-palmitoyl cysteine; C→S: Mild decrease of palmitoylation. Loss of localization to plasma membrane. Decreased palmitoylation; when associated with S-3, S-1110 and S-1111.
- 74 I→C: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-371.; I→K: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with E-371.
- 75 modified: Disulfide link with 309
- 85 P → L: in FHA1; Alabama; dbSNP:rs145183203
- 98 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 100 S→C: Highly decreased protein abundance. Highly decreased ATPase activity. Highly decreased phospholipid translocase activity.
- 210 E → D: in a colorectal cancer sample; somatic mutation
- 219 R → K: in dbSNP:rs2230806
- 230 R → C: in dbSNP:rs9282541
- 244 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 248 P → A: in dbSNP:rs142625938
- 255 A → T: in TGD; deficient cellular cholesterol efflux; dbSNP:rs758100110
- 304 V→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane; when associated with C-308.
- 308 V→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane; when associated with C-304.
- 309 modified: Disulfide link with 75
- 364 S → C: in dbSNP:rs775035559
- 371 I→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane. 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-74 or C-375.; I→E: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-74.
- 375 L→C: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-371.
- 399 V → A: in dbSNP:rs9282543
- 401 K → Q: in dbSNP:rs138487227
- 496 R → W: in dbSNP:rs147675550
- 568 K→A: 60-65% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane.
- 573 Y→F: No effect on phospholipid and cholesterol efflux and on localization to cell membrane.
- 581 D→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-584 and K-585.
- 583 F→K: 90-95% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with E-590.
- 584 E→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-581 and K-585.
- 585 D→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-581 and K-584.
- 590 W → S: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; dbSNP:rs137854496; W→E: 90-95% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-583.
- 593 F→L: Moderately decreased protein abundance. Highly decreased ATPase activity. Highly decreased phospholipid translocase activity.
- 638 R → Q: in dbSNP:rs374190304
- 771 V → M: in dbSNP:rs2066718
- 774 T → P: in dbSNP:rs35819696; natural variant: T -> S
- 776 K → N: in dbSNP:rs138880920
- 815 E → G: in dbSNP:rs145582736
- 825 V → I: in dbSNP:rs2066715
- 883 I → M: in dbSNP:rs2066714
- 1172 E → D: in dbSNP:rs33918808
- 1181 S → F: in dbSNP:rs76881554
- 1216 G → V: in dbSNP:rs562403512
- 1341 R → T: in dbSNP:rs147743782
- 1376 S → G: in dbSNP:rs145689805
- 1379 L → F: in TGD; the mutant protein is retained in the endoplasmic reticulum while the wild-type protein is located at the plasma membrane
- 1407 A → T: in a colorectal cancer sample; somatic mutation; dbSNP:rs189206655
- 1463 modified: Disulfide link with 1477
- 1477 modified: Disulfide link with 1463; C → R: in TGD; loss of interaction with APOE; unable to generate APOE-containing high density lipoproteins; moderately decreased protein abundance; moderately decreased ATPase activity; moderately decreased phospholipid translocase activity; dbSNP:rs137854494
- 1512 T→M: Moderately decreased protein abundance. Does not affect ATPase activity. Moderately decreased phospholipid translocase activity.
- 1555 I → T: in dbSNP:rs1997618
- 1587 K → R: in dbSNP:rs2230808
- 1611 N → D: in FHA1; deficient cellular cholesterol efflux
- 1615 R → Q: in dbSNP:rs1251839800
- 1648 L → P: in dbSNP:rs1883024
- 1670 A → T: in dbSNP:rs1203589782
- 1680 R → Q: in dbSNP:rs150125857
- 1704 V → D: in TGD; the mutant protein is retained in the endoplasmic reticulum while the wild-type protein is located at the plasma membrane
- 1731 S → C: in dbSNP:rs760507032
- 1897 R → W: in FHA1; uncertain significance; dbSNP:rs760768125
- 1925 R → Q: in Scott syndrome; shows impaired trafficking of the mutant protein to the plasma membrane; dbSNP:rs142688906
- 1952 K→M: Inhibits ATPase activity; when associated with M-939. Decreases translocase activity; when associated with M-939. Does not affect protein subcellular localization in plasma membrane and endosome; when associated with M-939.
- 2054 modified: Phosphoserine; by PKA
- 2081 R → W: in TGD; highly decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; loss protein subcellular localization to the plasma membrane; dbSNP:rs137854501
- 2109 A → T: in a colorectal cancer sample; somatic mutation
- 2150 P → L: in FHA1; moderately decreased protein abundance; does not affect ATPase activity; moderately decreased phospholipid translocase activity; dbSNP:rs369098049
- 2163 natural variant: F -> S
- 2168 L → P: in dbSNP:rs2853577
- 2243 D → E: in dbSNP:rs34879708
- 2244 V → I: in dbSNP:rs144588452
Q8R420 Phospholipid-transporting ATPase ABCA3; ATP-binding cassette sub-family A member 3; Xenobiotic-transporting ATPase ABCA3; EC 7.6.2.1; EC 7.6.2.2 from Mus musculus (Mouse) (see paper)
28% identity, 92% coverage: 6:266/284 of query aligns to 1376:1637/1704 of Q8R420
Sites not aligning to the query:
- 292 E→V: Knockin new born mice are healthy and survive into adulthood without overt signs of respiratory distress. Knockin mice show a severe lung phenotype that begins with alveolar inflammatory cell infiltration at the early stage of the mouse life followed by aberrant lung remodeling with characteristics of diffuse parenchymal lung disease (DPLD)- and emphysema-like alveolar disruption in older mice.
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
29% identity, 74% coverage: 12:220/284 of query aligns to 7:211/353 of 1vciA
Query Sequence
>6939481 FitnessBrowser__SB2B:6939481
MDMELMNDGPLLEIRGLKKRFGDKTALNGVDLTLESGMVVGLLGENGAGKSTLMRCILGL
IDADEGEICTLGQAPSTLSASTKARIGYVPQQHYGYEGFSVERALSLHASFYPDWDPKLE
QSWMKRFGLDPKAQVNRLSVGQRQSLAIIMAMAYRPSLLVLDEPVASLDPSARRRFMGDL
FELALESGSAVIFSSHITSDLERVASHVALLKDGQLLIMGELDAVRESVRLLTLAEGSQL
PDAYRVLGRQGNRVLVDGFRGESFPGLLGVDTVNLEQLFMELHP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory