SitesBLAST
Comparing 7023349 FitnessBrowser__ANA3:7023349 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5vg6B Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with NADPH and mes.
33% identity, 81% coverage: 59:310/310 of query aligns to 65:315/315 of 5vg6B
- active site: M98 (vs. gap), R230 (= R225), D254 (= D249), E259 (= E254), H278 (= H273)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A74 (= A68), R92 (≠ G89), M102 (= M95), L147 (≠ T142), G148 (= G143), D149 (≠ S144), L150 (≠ I145), W168 (≠ I163), S169 (≠ N164), R170 (= R165), T171 (≠ S166), K173 (≠ R168), L201 (= L196), P202 (= P197), T207 (= T202), V228 (= V223), R230 (= R225), H278 (= H273), A280 (≠ S275), S281 (≠ A276), Y315 (= Y310)
5mh6A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-ketohexanoic acid and NAD+ (1.35 a resolution)
30% identity, 79% coverage: 61:304/310 of query aligns to 58:305/306 of 5mh6A
- binding 2-Ketohexanoic acid: R64 (≠ F67), A65 (= A68), G66 (= G69), H89 (≠ F91), R224 (= R225), H272 (= H273), Y280 (≠ H279)
- binding magnesium ion: T130 (≠ S131), A132 (≠ Q133), F210 (≠ L211), E211 (≠ A212), M213 (≠ L214), G225 (= G226), P226 (≠ D227), V228 (≠ L229), E230 (≠ L231), D241 (≠ P242), S251 (≠ T252)
- binding nicotinamide-adenine-dinucleotide: A65 (= A68), G66 (= G69), T86 (≠ K88), H89 (≠ F91), G142 (= G143), T143 (≠ S144), L144 (≠ I145), R164 (= R165), P196 (= P197), T201 (= T202), V222 (= V223), A223 (≠ G224), R224 (= R225), H272 (= H273), S274 (= S275)
5mhaB D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
30% identity, 79% coverage: 61:304/310 of query aligns to 60:307/308 of 5mhaB
- binding 2-Ketohexanoic acid: R66 (≠ F67), R226 (= R225), H274 (= H273), Y282 (≠ H279)
- binding (2R)-2-hydroxyhexanoic acid: R66 (≠ F67), A67 (= A68), G68 (= G69), H91 (≠ F91), Y282 (≠ H279)
- binding magnesium ion: F212 (≠ L211), E213 (≠ A212), M215 (≠ L214), D243 (≠ P242)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A67 (= A68), G68 (= G69), T88 (≠ K88), L143 (≠ T142), G144 (= G143), T145 (≠ S144), L146 (≠ I145), R165 (≠ N164), R166 (= R165), S167 (= S166), P180 (≠ L179), T197 (≠ L196), P198 (= P197), T203 (= T202), V224 (= V223), A225 (≠ G224), R226 (= R225), H274 (= H273), S276 (= S275)
5mhaA D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
30% identity, 79% coverage: 61:304/310 of query aligns to 60:307/308 of 5mhaA
- binding 2-Ketohexanoic acid: R66 (≠ F67), A67 (= A68), G68 (= G69), H91 (≠ F91), R226 (= R225), H274 (= H273), Y282 (≠ H279)
- binding magnesium ion: T132 (≠ S131), A134 (≠ Q133)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A67 (= A68), G68 (= G69), T88 (≠ K88), L143 (≠ T142), G144 (= G143), T145 (≠ S144), L146 (≠ I145), R165 (≠ N164), R166 (= R165), S167 (= S166), P180 (≠ L179), T197 (≠ L196), P198 (= P197), T203 (= T202), V224 (= V223), A225 (≠ G224), R226 (= R225), H274 (= H273), S276 (= S275)
5mh5A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-keto-hexanoic acid and NADP+ (1.4 a resolution)
30% identity, 79% coverage: 61:304/310 of query aligns to 60:307/308 of 5mh5A
- binding 2-Ketohexanoic acid: R66 (≠ F67), A67 (= A68), G68 (= G69), H91 (≠ F91), R226 (= R225), H274 (= H273), Y282 (≠ H279)
- binding magnesium ion: T132 (≠ S131), A134 (≠ Q133), F212 (≠ L211), E213 (≠ A212), M215 (≠ L214), D243 (≠ P242)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A67 (= A68), G68 (= G69), T88 (≠ K88), G142 (= G141), L143 (≠ T142), G144 (= G143), T145 (≠ S144), L146 (≠ I145), R165 (≠ N164), R166 (= R165), S167 (= S166), T197 (≠ L196), P198 (= P197), T203 (= T202), V224 (= V223), A225 (≠ G224), R226 (= R225), H274 (= H273), S276 (= S275)
4zqbB Crystal structure of NADP-dependent dehydrogenase from rhodobactersphaeroides in complex with NADP and sulfate
33% identity, 94% coverage: 21:310/310 of query aligns to 26:316/316 of 4zqbB
- active site: L99 (≠ F91), R231 (= R225), E260 (= E254), H279 (= H273)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R93 (≠ Q83), M103 (= M95), G147 (= G141), L148 (≠ T142), G149 (= G143), E150 (≠ S144), L151 (≠ I145), W169 (≠ I163), S170 (≠ N164), R171 (= R165), S172 (= S166), K174 (≠ R168), L202 (= L196), P203 (= P197), F229 (≠ V223), R231 (= R225), H279 (= H273), S281 (= S275), A282 (= A276), Y316 (= Y310)
4z0pA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
28% identity, 94% coverage: 21:310/310 of query aligns to 20:316/316 of 4z0pA
- active site: L95 (≠ F91), R231 (= R225), G250 (≠ A240), D255 (= D249), E260 (= E254), H279 (= H273)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (≠ N86), M99 (= M95), M144 (≠ T142), G145 (= G143), V146 (≠ S144), L147 (≠ I145), W165 (≠ I163), S166 (≠ N164), R167 (= R165), S168 (= S166), R170 (= R168), L197 (= L196), P198 (= P197), A229 (≠ V223), G230 (= G224), R231 (= R225), H279 (= H273), A281 (≠ S275), A282 (= A276), Y316 (= Y310)
- binding oxalic acid: W50 (= W43), G70 (≠ F67), A71 (= A68), G72 (= G69), H114 (= H110), R115 (≠ Q111), R231 (= R225), H279 (= H273)
4weqA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADP and sulfate (see paper)
28% identity, 94% coverage: 21:310/310 of query aligns to 20:316/316 of 4weqA
- active site: L95 (≠ F91), R231 (= R225), G250 (≠ A240), D255 (= D249), E260 (= E254), H279 (= H273)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R89 (≠ N86), M99 (= M95), M144 (≠ T142), G145 (= G143), V146 (≠ S144), L147 (≠ I145), W165 (≠ I163), S166 (≠ N164), R167 (= R165), S168 (= S166), R170 (= R168), L197 (= L196), P198 (= P197), A229 (≠ V223), G230 (= G224), R231 (= R225), D255 (= D249), H279 (= H273), A281 (≠ S275), Y316 (= Y310)
5bqfA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADP, hepes and l(+)-tartaric acid
27% identity, 84% coverage: 51:310/310 of query aligns to 55:317/317 of 5bqfA
- active site: E261 (= E254), H280 (= H273)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A72 (= A68), R90 (≠ N86), M100 (= M95), G144 (= G141), L145 (≠ T142), G146 (= G143), I147 (≠ S144), L148 (≠ I145), W166 (≠ I163), S167 (≠ N164), R168 (= R165), T169 (≠ S166), L198 (= L196), P199 (= P197), A230 (≠ V223), G231 (= G224), R232 (= R225), H280 (= H273), A283 (= A276), Y317 (= Y310)
4xcvA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH
27% identity, 84% coverage: 51:310/310 of query aligns to 55:317/317 of 4xcvA
- active site: E261 (= E254), H280 (= H273)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A72 (= A68), R90 (≠ N86), M100 (= M95), G144 (= G141), L145 (≠ T142), G146 (= G143), I147 (≠ S144), L148 (≠ I145), W166 (≠ I163), S167 (≠ N164), R168 (= R165), T169 (≠ S166), K171 (≠ R168), L198 (= L196), P199 (= P197), A230 (≠ V223), G231 (= G224), R232 (= R225), H280 (= H273), A283 (= A276), Y317 (= Y310)
5tsdA Crystal structure of NADPH-dependent 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH and oxalate
27% identity, 84% coverage: 51:310/310 of query aligns to 54:316/316 of 5tsdA
- active site: E260 (= E254), H279 (= H273)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A71 (= A68), R89 (≠ N86), M99 (= M95), G143 (= G141), L144 (≠ T142), G145 (= G143), I146 (≠ S144), L147 (≠ I145), W165 (≠ I163), S166 (≠ N164), R167 (= R165), T168 (≠ S166), K170 (≠ R168), L197 (= L196), P198 (= P197), A229 (≠ V223), G230 (= G224), R231 (= R225), D255 (= D249), H279 (= H273), Y316 (= Y310)
- binding oxalic acid: G70 (≠ F67), A71 (= A68), G72 (= G69), R231 (= R225), H279 (= H273)
Sites not aligning to the query:
7jqiA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with alpha-ketoglutarate and NADP+
31% identity, 71% coverage: 91:310/310 of query aligns to 95:312/312 of 7jqiA
- binding 2-oxoglutaric acid: R227 (= R225), H275 (= H273)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: M99 (= M95), A144 (≠ T142), G145 (= G143), V146 (≠ S144), L147 (≠ I145), W165 (≠ I163), S166 (≠ N164), R167 (= R165), T168 (≠ S166), K170 (≠ R168), L198 (= L196), P199 (= P197), L225 (≠ V223), R227 (= R225), H275 (= H273), A278 (= A276), Y312 (= Y310)
Sites not aligning to the query:
6p35A 2.5 angstrom structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with 2-keto arginine and NADP
31% identity, 71% coverage: 91:310/310 of query aligns to 95:312/312 of 6p35A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: M99 (= M95), A144 (≠ T142), G145 (= G143), V146 (≠ S144), L147 (≠ I145), W165 (≠ I163), S166 (≠ N164), R167 (= R165), T168 (≠ S166), K170 (≠ R168), L198 (= L196), P199 (= P197), L225 (≠ V223), R227 (= R225), H275 (= H273), A277 (≠ S275), A278 (= A276), Y312 (= Y310)
- binding 5-[(diaminomethylidene)amino]-2-oxopentanoic acid: R227 (= R225), H275 (= H273), T280 (≠ S278)
Sites not aligning to the query:
7jqhA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with phosphate and NADP+
31% identity, 71% coverage: 91:310/310 of query aligns to 96:313/313 of 7jqhA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: M100 (= M95), A145 (≠ T142), G146 (= G143), V147 (≠ S144), L148 (≠ I145), W166 (≠ I163), S167 (≠ N164), R168 (= R165), T169 (≠ S166), K171 (≠ R168), L199 (= L196), P200 (= P197), L226 (≠ V223), A227 (≠ G224), R228 (= R225), D252 (= D249), H276 (= H273), A279 (= A276), Y313 (= Y310)
Sites not aligning to the query:
3kboA 2.14 angstrom crystal structure of putative oxidoreductase (ycdw) from salmonella typhimurium in complex with NADP
28% identity, 90% coverage: 31:310/310 of query aligns to 35:312/312 of 3kboA
- active site: M95 (vs. gap), R227 (= R225), E256 (= E254), H275 (= H273)
- binding N-(2-hydroxyethyl)-N,N-dimethyl-3-sulfopropan-1-aminium: N36 (≠ D32), A53 (= A51), R55 (≠ K58), R56 (≠ Q59)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (vs. gap), M99 (= M95), G143 (= G141), A144 (≠ T142), G145 (= G143), V146 (≠ S144), L147 (≠ I145), W165 (≠ I163), S166 (≠ N164), R167 (= R165), S168 (= S166), K170 (≠ R168), L197 (= L195), P199 (= P197), L225 (≠ V223), A226 (≠ G224), R227 (= R225), D251 (= D249), H275 (= H273), A278 (= A276), Y312 (= Y310)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
31% identity, 81% coverage: 27:278/310 of query aligns to 36:283/304 of 1wwkA
- active site: S96 (≠ F91), R230 (= R225), D254 (= D249), E259 (= E254), H278 (= H273)
- binding nicotinamide-adenine-dinucleotide: V100 (≠ M95), G146 (= G141), F147 (≠ T142), G148 (= G143), R149 (≠ S144), I150 (= I145), Y168 (≠ I163), D169 (≠ N164), P170 (vs. gap), V201 (≠ L196), P202 (= P197), T207 (= T202), T228 (≠ V223), S229 (≠ G224), D254 (= D249), H278 (= H273), G280 (≠ S275)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
29% identity, 72% coverage: 56:278/310 of query aligns to 64:293/334 of 5aovA
- active site: L100 (≠ F91), R241 (= R225), D265 (= D249), E270 (= E254), H288 (= H273)
- binding glyoxylic acid: Y74 (≠ S66), A75 (≠ F67), V76 (≠ A68), G77 (= G69), R241 (= R225), H288 (= H273)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ A68), T104 (≠ M95), F158 (≠ T142), G159 (= G143), R160 (≠ S144), I161 (= I145), S180 (≠ N164), R181 (= R165), A211 (≠ L195), V212 (≠ L196), P213 (= P197), T218 (= T202), I239 (≠ V223), A240 (≠ G224), R241 (= R225), H288 (= H273), G290 (≠ S275)
Sites not aligning to the query:
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
33% identity, 55% coverage: 107:278/310 of query aligns to 119:292/332 of 6biiA
- active site: R240 (= R225), D264 (= D249), E269 (= E254), H287 (= H273)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G156 (= G141), F157 (≠ T142), G158 (= G143), R159 (≠ S144), I160 (= I145), A179 (≠ N164), R180 (= R165), S181 (= S166), K183 (≠ R168), V211 (≠ L196), P212 (= P197), E216 (= E201), T217 (= T202), V238 (= V223), A239 (≠ G224), R240 (= R225), D264 (= D249), H287 (= H273), G289 (≠ S275)
Sites not aligning to the query:
1psdA The allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase (see paper)
28% identity, 61% coverage: 95:282/310 of query aligns to 106:295/404 of 1psdA
- active site: R234 (= R225), D258 (= D249), E263 (= E254), H286 (= H273)
- binding nicotinamide-adenine-dinucleotide: H155 (≠ S144), I156 (= I145), D175 (≠ N164), I176 (≠ R165), K179 (≠ R168), H204 (≠ L195), V205 (≠ L196), P206 (= P197), A232 (≠ V223), S233 (≠ G224), R234 (= R225), H286 (= H273)
Sites not aligning to the query:
P0A9T0 D-3-phosphoglycerate dehydrogenase; PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Escherichia coli (strain K12) (see 2 papers)
28% identity, 61% coverage: 95:282/310 of query aligns to 112:301/410 of P0A9T0
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Query Sequence
>7023349 FitnessBrowser__ANA3:7023349
MGHKLLLLTKANEQYRQLIEAQQLPGLELLDDNPANIAEANIWLAEPKLAAPLVPHAKQL
KWLQSSFAGIDALMGPRARKDYQLTNIKGIFGPLMSEYLFGYLLAHVRGHQFYQAQQRQK
SWQVQSATRGSLQGMRLLLLGTGSIAQHVAKTAKHFGMHITGINRSGREVDGFDLIQPLS
QLGQCLSQSDVVTNLLPSTPETRLLLNADMLATLKADAILVNVGRGDVLDLDALNTQLIA
RPEQHAVLDVFTQEPLPASHPIWERPNAIITPHISAPSHPEQIVRIFSDNYRRYIAAEPL
QNQVDFIQGY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory