Comparing 7025581 FitnessBrowser__ANA3:7025581 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
62% identity, 92% coverage: 24:272/272 of query aligns to 9:257/257 of P0AAH0
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
38% identity, 89% coverage: 26:267/272 of query aligns to 3:236/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
39% identity, 86% coverage: 35:268/272 of query aligns to 11:237/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
36% identity, 89% coverage: 26:268/272 of query aligns to 4:239/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
36% identity, 89% coverage: 26:268/272 of query aligns to 4:239/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
36% identity, 89% coverage: 26:268/272 of query aligns to 4:239/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
36% identity, 89% coverage: 26:268/272 of query aligns to 4:239/242 of 2oljA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 84% coverage: 39:267/272 of query aligns to 19:241/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
35% identity, 84% coverage: 39:267/272 of query aligns to 20:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
35% identity, 84% coverage: 39:267/272 of query aligns to 20:242/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
35% identity, 84% coverage: 39:267/272 of query aligns to 20:242/344 of 6cvlD
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
34% identity, 86% coverage: 34:267/272 of query aligns to 35:259/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
34% identity, 86% coverage: 34:267/272 of query aligns to 35:259/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
33% identity, 86% coverage: 34:267/272 of query aligns to 35:259/260 of 7ahdC
Sites not aligning to the query:
7qkrA Cryo-em structure of abc transporter ste6-2p from pichia pastoris with verapamil at 3.2 a resolution (see paper)
32% identity, 85% coverage: 18:247/272 of query aligns to 354:587/1199 of 7qkrA
Sites not aligning to the query:
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
35% identity, 91% coverage: 22:269/272 of query aligns to 3:255/258 of P02915
Q5M244 Energy-coupling factor transporter ATP-binding protein EcfA2; ECF transporter A component EcfA2; EC 3.6.3.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
33% identity, 81% coverage: 37:255/272 of query aligns to 19:233/280 of Q5M244
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
36% identity, 90% coverage: 26:269/272 of query aligns to 3:251/258 of 1b0uA
3d31A Modbc from methanosarcina acetivorans (see paper)
29% identity, 98% coverage: 1:267/272 of query aligns to 1:228/348 of 3d31A
Sites not aligning to the query:
7o9wA Encequidar-bound human p-glycoprotein in complex with uic2-fab (see paper)
34% identity, 70% coverage: 37:227/272 of query aligns to 942:1127/1169 of 7o9wA
Sites not aligning to the query:
>7025581 FitnessBrowser__ANA3:7025581
MISIDSTAMKTNNFDLANLSQNDTALEIRNLDLRYGDKQALFNVSMKIPKKQVTAFIGPS
GCGKSTLLRCINRMNDLVDNCHIDGEILLHGQNIYDKKIDVAALRRNVGMVFQRPNPFPK
SIYENVVYGLRLQGINNRRELDEAAERSLRGAAIWDEVKDRLHDNAFGLSGGQQQRLVIA
RAIAIEPEVLLLDEPTSALDPISTLTIEELITELKTKYTVVIVTHNMQQAARVSDQTAFM
YMGELVEYADTNTIFTTPKKRKTEDYITGRYG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory