Comparing 7025629 FitnessBrowser__ANA3:7025629 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
Q02I31 Putative pterin-4-alpha-carbinolamine dehydratase; PHS; 4-alpha-hydroxy-tetrahydropterin dehydratase; Pterin carbinolamine dehydratase; PCD; EC 4.2.1.96 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
72% identity, 98% coverage: 1:110/112 of query aligns to 1:110/118 of Q02I31
2v6tB Crystal structure of a complex of pterin-4a-carbinolamine dehydratase from toxoplasma gondii with 7,8-dihydrobiopterin (see paper)
31% identity, 78% coverage: 22:108/112 of query aligns to 9:93/100 of 2v6tB
>7025629 FitnessBrowser__ANA3:7025629
MTALTQMKCEACQADAPKVTDAELAELIRMVPDWGVQVRDGIMQLERVYKFKNFKLAMAF
TNKLADLAEEEFHHPGILTEWGKVTVTWWSHSIKGLHKNDFIMAAKTDQLLD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory