Comparing 7026062 FitnessBrowser__ANA3:7026062 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q88QT2 N-acetylmuramate alpha-1-phosphate uridylyltransferase; MurNAc-1P uridylyltransferase; MurNAc-alpha-1P uridylyltransferase; EC 2.7.7.99 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
55% identity, 99% coverage: 1:218/221 of query aligns to 1:217/223 of Q88QT2
4y7uA Structural analysis of muru (see paper)
55% identity, 99% coverage: 1:218/221 of query aligns to 1:217/224 of 4y7uA
4y7vA Structural analysis of muru (see paper)
54% identity, 99% coverage: 1:218/221 of query aligns to 1:212/216 of 4y7vA
P74285 UTP--glucose-1-phosphate uridylyltransferase; Cyanobacterial UDP-glucose pyrophosphorylase; UDP-glucose pyrophosphorylase; UDP-Glc PPase; EC 2.7.7.9 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
32% identity, 100% coverage: 1:221/221 of query aligns to 1:247/388 of P74285
7whsA Cryo-em structure of leishmanial gdp-mannose pyrophosphorylase in complex with gtp (see paper)
42% identity, 50% coverage: 1:111/221 of query aligns to 1:111/366 of 7whsA
Sites not aligning to the query:
7whtA Cryo-em structure of leishmanial gdp-mannose pyrophosphorylase in complex with gdp-mannose (see paper)
42% identity, 50% coverage: 1:111/221 of query aligns to 1:111/360 of 7whtA
Sites not aligning to the query:
7d73E Cryo-em structure of gmppa/gmppb complex bound to gtp (state i) (see paper)
41% identity, 52% coverage: 1:114/221 of query aligns to 1:114/360 of 7d73E
7d72K Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
41% identity, 52% coverage: 1:114/221 of query aligns to 1:114/360 of 7d72K
Sites not aligning to the query:
7d72E Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
41% identity, 52% coverage: 1:114/221 of query aligns to 1:114/360 of 7d72E
Sites not aligning to the query:
O22287 Mannose-1-phosphate guanylyltransferase 1; GDP-mannose pyrophosphorylase 1; Protein CYTOKINESIS DEFECTIVE 1; Protein EMBRYO DEFECTIVE 101; Protein HYPERSENSITIVE TO AMMONIUM ION 1; Protein SENSITIVE TO OZONE 1; Protein VITAMIN C DEFECTIVE 1; EC 2.7.7.13 from Arabidopsis thaliana (Mouse-ear cress) (see 5 papers)
42% identity, 51% coverage: 1:112/221 of query aligns to 1:113/361 of O22287
Sites not aligning to the query:
7x8kA Arabidopsis gdp-d-mannose pyrophosphorylase (vtc1) structure (product- bound) (see paper)
42% identity, 51% coverage: 1:112/221 of query aligns to 1:113/365 of 7x8kA
Sites not aligning to the query:
7x8kB Arabidopsis gdp-d-mannose pyrophosphorylase (vtc1) structure (product- bound) (see paper)
42% identity, 51% coverage: 1:112/221 of query aligns to 1:113/367 of 7x8kB
3hl3A 2.76 angstrom crystal structure of a putative glucose-1-phosphate thymidylyltransferase from bacillus anthracis in complex with a sucrose.
28% identity, 97% coverage: 1:214/221 of query aligns to 2:228/246 of 3hl3A
4ecmA 2.3 angstrom crystal structure of a glucose-1-phosphate thymidylyltransferase from bacillus anthracis in complex with thymidine-5-diphospho-alpha-d-glucose and pyrophosphate (see paper)
28% identity, 97% coverage: 1:214/221 of query aligns to 3:229/245 of 4ecmA
5z09A St0452(y97n)-utp binding form (see paper)
34% identity, 63% coverage: 1:139/221 of query aligns to 1:130/401 of 5z09A
2ggqA Complex of hypothetical glucose-1-phosphate thymidylyltransferase from sulfolobus tokodaii
54% identity, 28% coverage: 1:62/221 of query aligns to 1:67/401 of 2ggqA
Sites not aligning to the query:
Q975F9 Bifunctional sugar-1-phosphate nucleotidylyltransferase/acetyltransferase; EC 2.7.7.24; EC 2.7.7.9; EC 2.7.7.83; EC 2.7.7.23; EC 2.3.1.276; EC 2.3.1.157 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see 3 papers)
54% identity, 28% coverage: 1:62/221 of query aligns to 1:67/401 of Q975F9
Sites not aligning to the query:
3pkqA Q83d variant of s. Enterica rmla with dgtp (see paper)
29% identity, 94% coverage: 2:209/221 of query aligns to 3:224/285 of 3pkqA
6jq8A Crystal structure of hddc from yersinia pseudotuberculosis complexed with gmp-pn (see paper)
29% identity, 51% coverage: 3:114/221 of query aligns to 4:112/225 of 6jq8A
6n0uA Crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia phymatum bound to 2'-deoxy-thymidine-b-l-rhamnose
27% identity, 95% coverage: 2:212/221 of query aligns to 5:220/295 of 6n0uA
>7026062 FitnessBrowser__ANA3:7026062
MKAMILAAGRGERLRPLTDTLPKPLVPVLGKPLIVYHIEKLAAAGIVDIVINHAWLGHKL
VETLGDGHAFGVKIQYSAEASALETGGGIKQALPLLTDDSDAPFLVLNGDVFIDALPTIV
PLADTALAHLWLVPNPEQHPNGDFALEQGLVREQGEQKYTFSGMGLYRPSFFNGTPDGAF
ALGPLLRAKMADGLISGAHFNGLWCDVGTIARLQALESALA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory