Comparing 7026138 FitnessBrowser__ANA3:7026138 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 78% coverage: 17:271/326 of query aligns to 8:265/265 of P07821
5x40A Structure of a cbio dimer bound with amppcp (see paper)
30% identity, 78% coverage: 21:275/326 of query aligns to 5:279/280 of 5x40A
O65934 ABC transporter ATP-binding/permease protein Rv1747; EC 7.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
31% identity, 72% coverage: 20:254/326 of query aligns to 318:557/865 of O65934
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 78% coverage: 5:257/326 of query aligns to 12:252/378 of P69874
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 63% coverage: 35:241/326 of query aligns to 16:224/240 of 4ymuJ
Sites not aligning to the query:
7vgfA Cryo-em structure of amp-pnp bound human abcb7
32% identity, 70% coverage: 8:236/326 of query aligns to 317:545/550 of 7vgfA
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
32% identity, 61% coverage: 32:231/326 of query aligns to 16:217/230 of 6z4wA
Sites not aligning to the query:
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
32% identity, 61% coverage: 32:231/326 of query aligns to 16:217/229 of 6z67B
Sites not aligning to the query:
O75027 Iron-sulfur clusters transporter ABCB7, mitochondrial; ATP-binding cassette sub-family B member 7, mitochondrial; ATP-binding cassette transporter 7; ABC transporter 7 protein from Homo sapiens (Human) (see 4 papers)
32% identity, 70% coverage: 8:236/326 of query aligns to 461:689/752 of O75027
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
28% identity, 74% coverage: 31:270/326 of query aligns to 15:243/393 of P9WQI3
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
34% identity, 62% coverage: 32:233/326 of query aligns to 14:217/222 of 8i6rB
Sites not aligning to the query:
1g291 Malk (see paper)
28% identity, 65% coverage: 28:240/326 of query aligns to 10:227/372 of 1g291
Sites not aligning to the query:
Q2G506 ATM1-type heavy metal exporter; ATP-binding cassette transporter Atm1; NaAtm1; EC 7.-.-.- from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199) (see paper)
32% identity, 65% coverage: 33:244/326 of query aligns to 374:586/608 of Q2G506
Sites not aligning to the query:
4mrvA Structure of a bacterial atm1-family abc transporter (see paper)
32% identity, 65% coverage: 33:244/326 of query aligns to 367:579/600 of 4mrvA
Sites not aligning to the query:
4mrsA Structure of a bacterial atm1-family abc transporter (see paper)
32% identity, 65% coverage: 33:244/326 of query aligns to 367:579/600 of 4mrsA
Sites not aligning to the query:
4mrpA Structure of a bacterial atm1-family abc transporter (see paper)
32% identity, 65% coverage: 33:244/326 of query aligns to 367:579/600 of 4mrpA
Sites not aligning to the query:
4mrnA Structure of a bacterial atm1-family abc transporter (see paper)
32% identity, 65% coverage: 33:244/326 of query aligns to 367:579/600 of 4mrnA
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
34% identity, 61% coverage: 32:231/326 of query aligns to 14:215/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
34% identity, 61% coverage: 32:231/326 of query aligns to 14:215/219 of 8w6iD
Sites not aligning to the query:
6parA Structure of a bacterial atm1-family abc exporter with mgamppnp bound (see paper)
32% identity, 65% coverage: 33:244/326 of query aligns to 353:565/578 of 6parA
Sites not aligning to the query:
>7026138 FitnessBrowser__ANA3:7026138
MHSTSSLAPLAPAATSANMALKVSQLSWAIEGKTILSEISFALPQGEMLGLIGPNGAGKS
SLLRCLYRFIRPAKGHISLFSQDISELSPKAFACKVAVVQQDTPQYFDMTTEQLVAMGLT
PHKGMFDTNSSGDGEKIAKALEKVGLSHKVHQQYDRLSGGEKQRALIARAIVQQPQLLIL
DEPTNHLDIRYQIQILELVRSLGISVIASIHDLNLACALCDHLLLLDKGQVSAMGTPAQV
LTEERIAEVFGVCAQVTPHPQHGNPLINYFYGYQKPKSDAVDAASDSHSVSAQARPSEAC
ACHNSGAPNEVLQRAALQNESVENTP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory