Comparing 7026499 FitnessBrowser__ANA3:7026499 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
42% identity, 88% coverage: 23:254/264 of query aligns to 70:301/307 of Q94JV5
Sites not aligning to the query:
P47016 Deaminated glutathione amidase; dGSH amidase; Nitrilase homolog 1; EC 3.5.1.128 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
36% identity, 95% coverage: 7:256/264 of query aligns to 26:302/307 of P47016
4hg5A Structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate (see paper)
36% identity, 95% coverage: 7:256/264 of query aligns to 23:299/304 of 4hg5A
4hg3A Structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate (see paper)
36% identity, 95% coverage: 7:256/264 of query aligns to 23:299/304 of 4hg3A
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
36% identity, 89% coverage: 23:256/264 of query aligns to 37:265/276 of Q9NQR4
4hgdA Structural insights into yeast nit2: c169s mutant of yeast nit2 in complex with an endogenous peptide-like ligand (see paper)
36% identity, 95% coverage: 7:256/264 of query aligns to 22:295/299 of 4hgdA
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
29% identity, 89% coverage: 5:240/264 of query aligns to 28:247/269 of 6ypaB
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
29% identity, 89% coverage: 5:240/264 of query aligns to 22:241/263 of 7ovgA
P46011 Bifunctional nitrilase/nitrile hydratase NIT4; Cyanoalanine nitrilase; Nitrilase 4; EC 3.5.5.1; EC 3.5.5.4; EC 4.2.1.65 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 77% coverage: 52:254/264 of query aligns to 116:323/355 of P46011
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
29% identity, 92% coverage: 5:246/264 of query aligns to 20:243/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
29% identity, 92% coverage: 5:246/264 of query aligns to 20:243/261 of 3klcA
Sites not aligning to the query:
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
29% identity, 92% coverage: 5:246/264 of query aligns to 21:244/262 of Q9UYV8
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
29% identity, 54% coverage: 83:224/264 of query aligns to 103:251/301 of 5h8iC
Sites not aligning to the query:
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
29% identity, 54% coverage: 83:224/264 of query aligns to 99:247/297 of 5h8jB
Sites not aligning to the query:
5h8lB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine (see paper)
28% identity, 54% coverage: 83:224/264 of query aligns to 100:248/298 of 5h8lB
Sites not aligning to the query:
4izuA The e41q mutant of the amidase from nesterenkonia sp. An1 showing the result of michael addition of acrylamide at the active site cysteine
28% identity, 61% coverage: 88:249/264 of query aligns to 99:249/254 of 4izuA
Sites not aligning to the query:
4iztA The e41q mutant of the amidase from nesterenkonia sp. An1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine
30% identity, 58% coverage: 88:241/264 of query aligns to 107:249/263 of 4iztA
5nycA A c145a mutant of nesterenkonia an1 amidase bound to propionitrile
28% identity, 61% coverage: 88:249/264 of query aligns to 106:256/261 of 5nycA
Sites not aligning to the query:
4izsA The c145a mutant of the amidase from nesterenkonia sp. An1 in complex with butyramide
28% identity, 61% coverage: 88:249/264 of query aligns to 106:256/261 of 4izsA
Sites not aligning to the query:
5nybA A c145a mutant of nesterenkonia an1 amidase bound to adipamide
29% identity, 58% coverage: 88:241/264 of query aligns to 106:248/262 of 5nybA
Sites not aligning to the query:
>7026499 FitnessBrowser__ANA3:7026499
MFIESQLEELTRERLQWDKDAPHLVVLPECSLLFGGHESQQLAYAGDSHLSPLKSALSAL
AARYCVYMVAGTIPALAEDGRVYSRCYLFDDKGDTLGQYDKLHLFDVDVADGTKQYRESE
TFCPGNHISVIDTPFGKIGLTICYDLRFPDLFRALRLAGAEVITVPSAFTKVTGEAHWQV
LLQARAIETQCFILAAAQWGAHNEGSRETWGQSMVISPWGEVIAEQKTGIGWVHADIDVA
EVHSIRSKMPVAQHNRFTAPNLKP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory