SitesBLAST
Comparing 7026537 FitnessBrowser__ANA3:7026537 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4r2wD X-ray structure of uridine phosphorylase from shewanella oneidensis mr-1 in complex with uridine at 1.6 a resolution (see paper)
99% identity, 100% coverage: 2:252/252 of query aligns to 1:251/251 of 4r2wD
- active site: H5 (= H6), G23 (= G24), R27 (= R28), R45 (= R46), E77 (= E78), R88 (= R89), T91 (= T92), R165 (= R166), I217 (= I218), V218 (= V219), R220 (= R221), M231 (= M232)
- binding glycerol: T91 (= T92), N130 (= N131), M194 (= M195), E195 (= E196), A204 (= A205)
- binding sulfate ion: G23 (= G24), R27 (= R28), R88 (= R89), G90 (= G91), T91 (= T92)
4yjkA Crystal structure of c212s mutant of shewanella oneidensis mr-1 uridine phosphorylase (see paper)
97% identity, 100% coverage: 2:252/252 of query aligns to 1:245/245 of 4yjkA
- active site: H5 (= H6), G23 (= G24), R27 (= R28), R45 (= R46), E77 (= E78), R88 (= R89), T91 (= T92), R165 (= R166), I217 (= I218), V218 (= V219), R220 (= R221)
- binding uracil: T91 (= T92), T92 (= T93), G93 (= G94), F159 (= F160), Q163 (= Q164), R165 (= R166), E193 (= E194)
4r2wF X-ray structure of uridine phosphorylase from shewanella oneidensis mr-1 in complex with uridine at 1.6 a resolution (see paper)
96% identity, 100% coverage: 2:252/252 of query aligns to 1:242/242 of 4r2wF
- active site: H5 (= H6), G23 (= G24), R27 (= R28), R45 (= R46), E77 (= E78), R88 (= R89), T91 (= T92), R165 (= R166), I217 (= I218), V218 (= V219), R220 (= R221)
- binding glycerol: N130 (= N131), A204 (= A205)
- binding sulfate ion: G23 (= G24), R27 (= R28), R88 (= R89), G90 (= G91), T91 (= T92)
- binding uridine: T91 (= T92), T92 (= T93), G93 (= G94), F159 (= F160), Q163 (= Q164), R165 (= R166), Y192 (= Y193), E193 (= E194), M194 (= M195), E195 (= E196)
1u1eA Structure of e. Coli uridine phosphorylase complexed to 5(phenylseleno)acyclouridine (psau) (see paper)
76% identity, 99% coverage: 2:251/252 of query aligns to 4:253/253 of 1u1eA
- active site: H8 (= H6), G26 (= G24), R30 (= R28), R48 (= R46), E80 (= E78), R91 (= R89), T94 (= T92), R168 (= R166), I220 (= I218), V221 (= V219), R223 (= R221), M234 (= M232)
- binding 1-((2-hydroxyethoxy)methyl)-5-(phenylselanyl)pyrimidine-2,4(1h,3h)-dione: F7 (= F5), H8 (= H6), T94 (= T92), T95 (= T93), G96 (= G94), F162 (= F160), Q166 (= Q164), R168 (= R166), E196 (= E194), M197 (= M195), I220 (= I218), E227 (= E225), P229 (= P227)
- binding phosphate ion: G26 (= G24), R30 (= R28), R91 (= R89), G93 (= G91), T94 (= T92)
1u1dA Structure of e. Coli uridine phosphorylase complexed to 5- (phenylthio)acyclouridine (ptau) (see paper)
76% identity, 99% coverage: 2:251/252 of query aligns to 4:253/253 of 1u1dA
- active site: H8 (= H6), G26 (= G24), R30 (= R28), R48 (= R46), E80 (= E78), R91 (= R89), T94 (= T92), R168 (= R166), I220 (= I218), V221 (= V219), R223 (= R221), M234 (= M232)
- binding 1-((2-hydroxyethoxy)methyl)-5-(phenylthio)pyrimidine-2,4(1h,3h)-dione: F7 (= F5), H8 (= H6), T94 (= T92), T95 (= T93), G96 (= G94), F162 (= F160), Q166 (= Q164), R168 (= R166), M197 (= M195), I220 (= I218), P229 (= P227)
- binding phosphate ion: G26 (= G24), R30 (= R28), R91 (= R89), G93 (= G91), T94 (= T92)
1u1cA Structure of e. Coli uridine phosphorylase complexed to 5- benzylacyclouridine (bau) (see paper)
76% identity, 99% coverage: 2:251/252 of query aligns to 4:253/253 of 1u1cA
- active site: H8 (= H6), G26 (= G24), R30 (= R28), R48 (= R46), E80 (= E78), R91 (= R89), T94 (= T92), R168 (= R166), I220 (= I218), V221 (= V219), R223 (= R221), M234 (= M232)
- binding 1-((2-hydroxyethoxy)methyl)-5-benzylpyrimidine-2,4(1h,3h)-dione: F7 (= F5), H8 (= H6), T94 (= T92), T95 (= T93), G96 (= G94), F162 (= F160), Q166 (= Q164), R168 (= R166), E196 (= E194), I220 (= I218), P229 (= P227)
- binding phosphate ion: G26 (= G24), R30 (= R28), R91 (= R89), G93 (= G91), T94 (= T92), E198 (= E196)
P12758 Uridine phosphorylase; UPase; UrdPase; EC 2.4.2.3 from Escherichia coli (strain K12) (see 3 papers)
76% identity, 99% coverage: 2:251/252 of query aligns to 4:253/253 of P12758
- D5 (= D3) mutation D->A,E,N: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1tgyA Structure of e. Coli uridine phosphorylase complexed with uracil and ribose 1-phosphate
76% identity, 99% coverage: 2:251/252 of query aligns to 1:250/250 of 1tgyA
- active site: H5 (= H6), G23 (= G24), R27 (= R28), R45 (= R46), E77 (= E78), R88 (= R89), T91 (= T92), R165 (= R166), I217 (= I218), V218 (= V219), R220 (= R221), M231 (= M232)
- binding 1-O-phosphono-alpha-D-ribofuranose: H5 (= H6), G23 (= G24), R27 (= R28), R45 (= R46), R88 (= R89), T91 (= T92), F159 (= F160), M194 (= M195), E195 (= E196)
- binding uracil: G93 (= G94), F159 (= F160), Q163 (= Q164), R165 (= R166)
1rxcJ E. Coli uridine phosphorylase: 5-fluorouracil ribose-1-phosphate complex (see paper)
76% identity, 99% coverage: 2:251/252 of query aligns to 1:250/250 of 1rxcJ
- active site: H5 (= H6), G23 (= G24), R27 (= R28), R45 (= R46), E77 (= E78), R88 (= R89), T91 (= T92), R165 (= R166), I217 (= I218), V218 (= V219), R220 (= R221), M231 (= M232)
- binding 5-fluorouridine: I66 (= I67), T91 (= T92), T92 (= T93), G93 (= G94), F159 (= F160), Q163 (= Q164), E193 (= E194), M194 (= M195), E195 (= E196), I217 (= I218)
- binding potassium ion: E46 (= E47), G65 (= G66), I66 (= I67), S70 (= S71)
- binding phosphate ion: G23 (= G24), R27 (= R28), R88 (= R89), G90 (= G91), T91 (= T92)
- binding 1-O-phosphono-alpha-D-ribofuranose: H5 (= H6), R45 (= R46)
1rxcB E. Coli uridine phosphorylase: 5-fluorouracil ribose-1-phosphate complex (see paper)
76% identity, 99% coverage: 2:251/252 of query aligns to 1:250/250 of 1rxcB
- active site: H5 (= H6), G23 (= G24), R27 (= R28), R45 (= R46), E77 (= E78), R88 (= R89), T91 (= T92), R165 (= R166), I217 (= I218), V218 (= V219), R220 (= R221), M231 (= M232)
- binding potassium ion: E46 (= E47), G65 (= G66), I66 (= I67), S70 (= S71)
- binding 1-O-phosphono-alpha-D-ribofuranose: G23 (= G24), R27 (= R28), R88 (= R89), T91 (= T92), E193 (= E194), M194 (= M195), E195 (= E196)
- binding 5-fluorouracil: T91 (= T92), T92 (= T93), G93 (= G94), F159 (= F160), Q163 (= Q164), I217 (= I218), V218 (= V219)
2hwuA Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with uridine and phosphate ion at 2.91a resolution
77% identity, 99% coverage: 2:251/252 of query aligns to 4:253/253 of 2hwuA
- active site: R30 (= R28), R48 (= R46), R91 (= R89), R168 (= R166), I220 (= I218), V221 (= V219)
- binding uridine: T94 (= T92), T95 (= T93), G96 (= G94), F162 (= F160), Q166 (= Q164), E196 (= E194), M197 (= M195), E198 (= E196)
2hn9A Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with thymine and phosphate ion at 2.12a resolution
77% identity, 99% coverage: 2:251/252 of query aligns to 4:253/253 of 2hn9A
6rcaA X-ray structure uridine phosphorylase from vibrio cholerae in complex with 2.2'-anhydrouridine at 1.34 a
76% identity, 98% coverage: 4:251/252 of query aligns to 3:250/251 of 6rcaA
- active site: H5 (= H6), G23 (= G24), R27 (= R28), R45 (= R46), E77 (= E78), R88 (= R89), T91 (= T92), R165 (= R166), I217 (= I218), I218 (≠ V219), R220 (= R221), L231 (≠ M232)
- binding 2,2'-Anhydro-(1-beta-D-ribofuranosyl)uracil: T91 (= T92), F159 (= F160), Q163 (= Q164), E193 (= E194), M194 (= M195), E195 (= E196)
5efoE X-ray structure uridine phosphorylase from vibrio cholerae in complex with cytidine and cytosine at 1.63a.
76% identity, 98% coverage: 4:251/252 of query aligns to 3:250/251 of 5efoE
- active site: H5 (= H6), G23 (= G24), R27 (= R28), R45 (= R46), E77 (= E78), R88 (= R89), T91 (= T92), R165 (= R166), I217 (= I218), I218 (≠ V219), R220 (= R221), L231 (≠ M232)
- binding 4-amino-1-beta-d-ribofuranosyl-2(1h)-pyrimidinone: T91 (= T92), T92 (= T93), G93 (= G94), F159 (= F160), Q163 (= Q164), E193 (= E194), M194 (= M195), E195 (= E196)
5c80A X-ray structure uridine phosphorylase from vibrio cholerae in complex with uridine at 2.24 a resolution
76% identity, 98% coverage: 4:251/252 of query aligns to 3:250/251 of 5c80A
- active site: H5 (= H6), G23 (= G24), R27 (= R28), R45 (= R46), E77 (= E78), R88 (= R89), T91 (= T92), R165 (= R166), I217 (= I218), I218 (≠ V219), R220 (= R221), L231 (≠ M232)
- binding uridine: I66 (= I67), T91 (= T92), T92 (= T93), G93 (= G94), Q163 (= Q164), M194 (= M195), E195 (= E196)
5efoB X-ray structure uridine phosphorylase from vibrio cholerae in complex with cytidine and cytosine at 1.63a.
76% identity, 98% coverage: 4:251/252 of query aligns to 5:252/253 of 5efoB
- active site: H7 (= H6), G25 (= G24), R29 (= R28), R47 (= R46), E79 (= E78), R90 (= R89), T93 (= T92), R167 (= R166), I219 (= I218), I220 (≠ V219), R222 (= R221), L233 (≠ M232)
- binding 6-aminopyrimidin-2(1h)-one: T94 (= T93), G95 (= G94), F161 (= F160), Q165 (= Q164)
4k6oA X-ray structure uridine phosphorylase from vibrio cholerae in complex with 6-methyluracil at 1.17 a resolution (see paper)
76% identity, 98% coverage: 4:251/252 of query aligns to 4:251/252 of 4k6oA
- active site: H6 (= H6), G24 (= G24), R28 (= R28), R46 (= R46), E78 (= E78), R89 (= R89), T92 (= T92), R166 (= R166), I218 (= I218), I219 (≠ V219), R221 (= R221), L232 (≠ M232)
- binding 6-methylpyrimidine-2,4-diol: T92 (= T92), T93 (= T93), G94 (= G94), F160 (= F160), Q164 (= Q164), R166 (= R166)
1rxcA E. Coli uridine phosphorylase: 5-fluorouracil ribose-1-phosphate complex (see paper)
76% identity, 99% coverage: 2:251/252 of query aligns to 1:246/246 of 1rxcA
- active site: H5 (= H6), G23 (= G24), R27 (= R28), R45 (= R46), E77 (= E78), R88 (= R89), T91 (= T92), R165 (= R166), I217 (= I218), V218 (= V219), R220 (= R221)
- binding potassium ion: E46 (= E47), G65 (= G66), I66 (= I67), S70 (= S71)
- binding 1-O-phosphono-alpha-D-ribofuranose: H5 (= H6), R45 (= R46)
1rxsB E. Coli uridine phosphorylase: 2'-deoxyuridine phosphate complex (see paper)
76% identity, 99% coverage: 2:251/252 of query aligns to 1:246/246 of 1rxsB
- active site: H5 (= H6), R27 (= R28), R45 (= R46), E77 (= E78), R88 (= R89), R165 (= R166), I217 (= I218), V218 (= V219), R220 (= R221)
- binding 2'-deoxyuridine: T91 (= T92), T92 (= T93), G93 (= G94), F159 (= F160), Q163 (= Q164), M194 (= M195), E195 (= E196)
- binding potassium ion: E46 (= E47), G65 (= G66), I66 (= I67), S70 (= S71)
- binding meta vanadate: R175 (= R176), H176 (≠ R177)
4oglA X-ray structure uridine phosphorylase from vibrio cholerae in complex with thymine at 1.25 a resolution
75% identity, 98% coverage: 4:251/252 of query aligns to 3:246/247 of 4oglA
- active site: H5 (= H6), G23 (= G24), R27 (= R28), R45 (= R46), E77 (= E78), R88 (= R89), T91 (= T92), R165 (= R166), I217 (= I218), I218 (≠ V219), R220 (= R221), L227 (≠ M232)
- binding thymine: T92 (= T93), G93 (= G94), F159 (= F160), Q163 (= Q164), R165 (= R166), E193 (= E194), I217 (= I218)
Query Sequence
>7026537 FitnessBrowser__ANA3:7026537
MADVFHLGLTKAMLDGATLAIVPGDPERVKRIAELMDNATFLASHREYTSYLAYADGKPV
VICSTGIGGPSTSIAVEELAQLGVNTFLRVGTTGAIQPHVNVGDVIVTQASVRLDGASLH
FAPMEFPAVANFECTTAMVAACRDAGVEPHIGVTASSDTFYPGQERYDTVTGRVTRRFAG
SMKEWQDMGVLNYEMESATLFTMCATQGWRAACVAGVIVNRTQQEIPNEATMKQTEVSAV
SIVVAAAKKLLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory