Comparing 7026927 FitnessBrowser__ANA3:7026927 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
34% identity, 97% coverage: 1:356/368 of query aligns to 1:357/367 of P0A7B5
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
34% identity, 95% coverage: 9:356/368 of query aligns to 5:355/365 of 2j5tD
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
29% identity, 95% coverage: 9:356/368 of query aligns to 5:315/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
28% identity, 95% coverage: 9:356/368 of query aligns to 5:313/323 of 2j5vA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
35% identity, 67% coverage: 7:253/368 of query aligns to 1:240/241 of 2akoA
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
33% identity, 67% coverage: 7:254/368 of query aligns to 13:257/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
32% identity, 67% coverage: 7:254/368 of query aligns to 13:235/236 of 7f5xA
7lntB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to benzyl monophosphate and atp (see paper)
28% identity, 36% coverage: 117:248/368 of query aligns to 120:250/260 of 7lntB
Sites not aligning to the query:
7lnuB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to isopentenyl monophosphate and atp (see paper)
28% identity, 36% coverage: 117:248/368 of query aligns to 121:251/261 of 7lnuB
Sites not aligning to the query:
8u0mA Isopentenyl phosphate kinase (see paper)
26% identity, 41% coverage: 106:257/368 of query aligns to 107:247/247 of 8u0mA
Sites not aligning to the query:
7n9dA I74a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
27% identity, 36% coverage: 117:248/368 of query aligns to 119:247/253 of 7n9dA
Sites not aligning to the query:
8u0nA Isopentenyl phosphate kinase (see paper)
26% identity, 41% coverage: 106:257/368 of query aligns to 106:245/245 of 8u0nA
Sites not aligning to the query:
8u0lA Isopentenyl phosphate kinase (see paper)
26% identity, 41% coverage: 106:257/368 of query aligns to 108:247/247 of 8u0lA
Sites not aligning to the query:
8u0kA Isopentenyl phosphate kinase (see paper)
26% identity, 41% coverage: 106:257/368 of query aligns to 108:247/247 of 8u0kA
Sites not aligning to the query:
8u0mB Isopentenyl phosphate kinase (see paper)
26% identity, 41% coverage: 106:257/368 of query aligns to 108:247/247 of 8u0mB
Sites not aligning to the query:
Q8U122 Uridylate kinase; UK; Uridine monophosphate kinase; UMP kinase; UMPK; EC 2.7.4.22 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
28% identity, 30% coverage: 147:255/368 of query aligns to 120:225/225 of Q8U122
Sites not aligning to the query:
2bmuB Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp (see paper)
28% identity, 30% coverage: 147:255/368 of query aligns to 121:226/226 of 2bmuB
Sites not aligning to the query:
3ll9B X-ray structures of isopentenyl phosphate kinase (see paper)
26% identity, 35% coverage: 119:247/368 of query aligns to 127:241/249 of 3ll9B
Sites not aligning to the query:
3c1mC Cyrstal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with mgamp-pnp and l-aspartate (see paper)
24% identity, 37% coverage: 109:244/368 of query aligns to 167:297/468 of 3c1mC
Sites not aligning to the query:
3c1nA Crystal structure of allosteric inhibition threonine-sensitive aspartokinase from methanococcus jannaschii with l-threonine (see paper)
24% identity, 37% coverage: 109:244/368 of query aligns to 166:296/458 of 3c1nA
Sites not aligning to the query:
>7026927 FitnessBrowser__ANA3:7026927
MTDSPRKRIVVKVGSALIAPHKQGCSSHYLLGIAQFITYCRVQGIQVVLVSSGSVAAGWH
HFEGQAQPSVTVKKAMAAAGQADMMATWNKLFDFPTAQLLLTHGDLRNRERYISIRDTIF
SLLEHGLMPIINENDAVTADKLKVGDNDNLSAMVAAAADADTLVICSDVDGLYDQNPHEH
PNAKLIKQVTEINADIYAMAGGVSSDVGTGGMRTKIQAAEKAISHGIETFIINGFNADSF
SQLLKGQNPGTLFTPYEKPMQEHLHWMTHTSQAQGEVIVEDDFDLALDQHSEQLTSDDVV
EVKGDFSVGDTILVRKGDGTKLAKAKSNYSSCLLSFITEQDDQAFASEFQQKTGPIISDK
NIAILKSI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory