Comparing 8500076 FitnessBrowser__Miya:8500076 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4o48A Crystal structure of cleaved guinea pig l-asparaginase type iii in complex with l-aspartate (see paper)
40% identity, 99% coverage: 3:327/329 of query aligns to 3:289/298 of 4o48A
Q7L266 Isoaspartyl peptidase/L-asparaginase; Asparaginase-like protein 1; Beta-aspartyl-peptidase; Isoaspartyl dipeptidase; L-asparagine amidohydrolase; EC 3.4.19.5; EC 3.5.1.1 from Homo sapiens (Human) (see 4 papers)
39% identity, 91% coverage: 4:301/329 of query aligns to 3:274/308 of Q7L266
4osxA Structure of uncleaved glycine-bound human l-asparaginase protein (see paper)
39% identity, 91% coverage: 4:301/329 of query aligns to 4:266/300 of 4osxA
4pvrA Crystal structure of partially-cleaved human l-asparaginase protein in complex with l-aspartate (see paper)
39% identity, 91% coverage: 4:301/329 of query aligns to 4:264/298 of 4pvrA
4o0hA Crystal structure of human l-asparaginase protein with covalently linked substrate l-asparagine (see paper)
40% identity, 91% coverage: 4:301/329 of query aligns to 4:261/295 of 4o0hA
P37595 Isoaspartyl peptidase; Beta-aspartyl-peptidase; EcAIII; Isoaspartyl dipeptidase; EC 3.4.19.5 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 97% coverage: 1:318/329 of query aligns to 1:303/321 of P37595
Q47898 N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; AGA; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Elizabethkingia miricola (Chryseobacterium miricola) (see 5 papers)
33% identity, 85% coverage: 26:305/329 of query aligns to 59:315/340 of Q47898
Sites not aligning to the query:
1p4vA Crystal structure of the glycosylasparaginase precursor d151n mutant with glycine (see paper)
34% identity, 85% coverage: 26:305/329 of query aligns to 14:270/295 of 1p4vA
4r4yA Structural basis of a point mutation that causes the genetic disease aspartylglucosaminuria (see paper)
33% identity, 85% coverage: 26:305/329 of query aligns to 12:268/293 of 4r4yA
Q9H6P5 Threonine aspartase 1; Taspase-1; EC 3.4.25.- from Homo sapiens (Human) (see 2 papers)
32% identity, 79% coverage: 6:265/329 of query aligns to 44:311/420 of Q9H6P5
2a8jB Crystal structure of human taspase1 (acivated form) (see paper)
31% identity, 85% coverage: 6:285/329 of query aligns to 4:233/313 of 2a8jB
P20933 N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Homo sapiens (Human) (see 11 papers)
33% identity, 85% coverage: 28:306/329 of query aligns to 37:318/346 of P20933
Sites not aligning to the query:
8c23DDD Isoaspartyl peptidase subunit beta (see paper)
48% identity, 38% coverage: 194:318/329 of query aligns to 1:125/135 of 8c23DDD
2zalB Crystal structure of e. Coli isoaspartyl aminopeptidase/l-asparaginase in complex with l-aspartate (see paper)
47% identity, 38% coverage: 194:318/329 of query aligns to 1:125/135 of 2zalB
P30919 N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; AGA; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Rattus norvegicus (Rat) (see paper)
33% identity, 85% coverage: 28:306/329 of query aligns to 37:317/345 of P30919
Sites not aligning to the query:
2gezC Crystal structure of potassium-independent plant asparaginase (see paper)
37% identity, 43% coverage: 6:145/329 of query aligns to 5:149/166 of 2gezC
2gl9B Crystal structure of glycosylasparaginase-substrate complex (see paper)
40% identity, 34% coverage: 195:305/329 of query aligns to 2:119/144 of 2gl9B
Sites not aligning to the query:
4pv2C Crystal structure of potassium-dependent plant-type l-asparaginase from phaseolus vulgaris in complex with k+ and na+ cations (see paper)
36% identity, 39% coverage: 6:134/329 of query aligns to 5:137/158 of 4pv2C
8c0iAAA Isoaspartyl peptidase subunit alpha (see paper)
40% identity, 40% coverage: 6:135/329 of query aligns to 5:140/156 of 8c0iAAA
Sites not aligning to the query:
1jn9A Structure of putative asparaginase encoded by escherichia coli ybik gene (see paper)
40% identity, 40% coverage: 6:135/329 of query aligns to 5:140/158 of 1jn9A
>8500076 FitnessBrowser__Miya:8500076
MTEPRIIVHGGAWTIPADRRKAHVDGCRAAVDAVWGELRRGMPALEAVRLAVNVLEADPT
YDAGRGAVLNADGRIELDAAIMDGATLNFGAVAAVRNFLHPVDIARKVMDTEFCFLVGEG
AERFAREVGIEAIDPAELVVEREVRLYNELRARAGFSTHDSFRPRAGANGAAVEAPAVNG
TACRCPEPDMPKGTVGAVALDAAGNIAAATSTGGTPMKRPGRVGDSPLCGAGTYADNETG
GASATGFGEGIIRVLMTRSACDFLRDGGASPADAARRAIELLHRRVAGHAGLIMLDRQGR
YGVHCNTEHIAHAYALPGGGIHADVELRR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory