SitesBLAST
Comparing 8500375 FitnessBrowser__Miya:8500375 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
Q9SS48 Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial; Protein SUGAR-DEPENDENT 6; EC 1.1.5.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 97% coverage: 4:384/392 of query aligns to 76:473/629 of Q9SS48
- S86 (≠ A14) mutation to F: In spd6-2; loss of 90% of activity.
Sites not aligning to the query:
- 546 E→G: In spd6-1; loss of 90% of activity.
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
27% identity, 89% coverage: 4:353/392 of query aligns to 4:340/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I7), G8 (= G8), G10 (= G10), V11 (≠ G11), I12 (≠ T12), V30 (≠ Y30), E31 (= E31), K32 (≠ R32), E38 (≠ G38), A39 (≠ S39), S40 (≠ T40), A43 (≠ H43), G45 (= G45), L46 (= L46), V171 (= V167), G200 (≠ A208), G201 (= G209), W203 (= W211), G298 (≠ A310), R300 (= R312), P301 (= P313), Y326 (≠ T337), R327 (= R338), N328 (≠ D339), G329 (≠ N340), I330 (≠ V341)
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
25% identity, 76% coverage: 14:309/392 of query aligns to 17:304/374 of 1y56B
- active site: F44 (≠ G41), G47 (≠ H48), T48 (≠ S49), H224 (≠ G230), P239 (≠ N241)
- binding flavin-adenine dinucleotide: I33 (≠ Y30), E34 (= E31), K35 (≠ R32), S42 (= S39), T43 (= T40), R45 (= R42), C46 (≠ L47), G47 (≠ H48), G49 (= G50), E170 (= E166), V171 (= V167), T200 (≠ A208), N201 (≠ G209), W203 (= W211)
- binding flavin mononucleotide: F44 (≠ G41), R45 (= R42), I260 (≠ G266), R301 (≠ S306), W303 (= W308)
Sites not aligning to the query:
- active site: 305, 338
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 305, 306, 307, 334, 335, 336, 337, 338
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
29% identity, 57% coverage: 4:227/392 of query aligns to 4:219/827 of 3gsiA
- binding flavin-adenine dinucleotide: G10 (= G10), I11 (≠ G11), V12 (≠ T12), D32 (≠ E31), Q33 (≠ R32), G41 (= G38), S42 (= S39), T43 (= T40), H45 (≠ R42), P47 (≠ H44), L49 (= L46), T170 (≠ E166), V171 (= V167), A200 (= A208), G201 (= G209), W203 (= W211)
Sites not aligning to the query:
- active site: 222, 256, 549
- binding flavin-adenine dinucleotide: 222, 256, 330, 331, 332, 357, 358, 359, 360
- binding magnesium ion: 254, 409
- binding (6s)-5,6,7,8-tetrahydrofolate: 505, 536, 551, 563, 629, 648, 655, 696
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
29% identity, 57% coverage: 4:227/392 of query aligns to 4:219/827 of 1pj7A
- binding flavin-adenine dinucleotide: G8 (= G8), G10 (= G10), I11 (≠ G11), V12 (≠ T12), D32 (≠ E31), Q33 (≠ R32), G41 (= G38), S42 (= S39), T43 (= T40), H45 (≠ R42), P47 (≠ H44), L49 (= L46), T170 (≠ E166), V171 (= V167), A200 (= A208), G201 (= G209), W203 (= W211)
Sites not aligning to the query:
- active site: 222, 256, 549
- binding flavin-adenine dinucleotide: 222, 256, 331, 357, 358, 359, 360
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: 505, 536, 549, 551, 563, 629, 648, 655, 696
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
29% identity, 57% coverage: 4:227/392 of query aligns to 7:222/830 of Q9AGP8
Sites not aligning to the query:
- 225 Important for catalytic activity; H→Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- 259 Important for catalytic activity; binding ; Y→F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- 360:363 binding
- 539 binding
- 552 Important for catalytic activity; D→A: No effect on the activity.; D→N: Reduces activity 3-fold.
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
29% identity, 57% coverage: 4:227/392 of query aligns to 5:220/828 of 1pj6A
- binding flavin-adenine dinucleotide: G9 (= G8), G11 (= G10), I12 (≠ G11), V13 (≠ T12), D33 (≠ E31), Q34 (≠ R32), G42 (= G38), S43 (= S39), T44 (= T40), H46 (≠ R42), P48 (≠ H44), L50 (= L46), V172 (= V167), A201 (= A208), G202 (= G209), W204 (= W211)
Sites not aligning to the query:
2rgoB Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
23% identity, 91% coverage: 24:380/392 of query aligns to 39:403/530 of 2rgoB
- binding flavin-adenine dinucleotide: E46 (= E31), M47 (≠ R32), Q48 (≠ G33), T54 (≠ S39), S55 (≠ T40), S58 (≠ H43), T59 (≠ H44), A193 (≠ V167), S227 (≠ A208), G228 (= G209), W230 (= W211), L338 (≠ A311), R339 (= R312), Y350 (≠ R322), K374 (= K351), I375 (≠ G352), T376 (≠ M353)
Sites not aligning to the query:
2rgoA Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
23% identity, 91% coverage: 24:380/392 of query aligns to 41:411/557 of 2rgoA
- binding flavin-adenine dinucleotide: E48 (= E31), M49 (≠ R32), Q50 (≠ G33), T56 (≠ S39), S57 (≠ T40), A197 (≠ V167), S232 (≠ A208), G233 (= G209), W235 (= W211), G257 (= G230), G344 (≠ A310), L345 (≠ A311), Y357 (= Y333), K382 (= K351), I383 (≠ G352), T384 (≠ M353)
Sites not aligning to the query:
3da1A X-ray structure of the glycerol-3-phosphate dehydrogenase from bacillus halodurans complexed with fad. Northeast structural genomics consortium target bhr167.
24% identity, 92% coverage: 19:378/392 of query aligns to 36:347/496 of 3da1A
- binding flavin-adenine dinucleotide: E48 (= E31), M49 (≠ R32), G55 (= G38), S57 (≠ T40), S60 (≠ H43), T61 (≠ H44), L63 (= L46), H65 (= H48), V151 (= V167), G187 (= G209), W189 (= W211), L193 (vs. gap), G210 (= G228), T250 (= T267), G296 (≠ A310), R298 (= R312), G319 (= G350), K320 (= K351), L321 (≠ G352)
Sites not aligning to the query:
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
25% identity, 75% coverage: 19:313/392 of query aligns to 21:308/370 of 4yshA
- active site: A45 (≠ H43), M48 (≠ L46), L49 (= L47), Q52 (≠ G50), I262 (≠ V264), L283 (≠ M288), G305 (≠ A310)
- binding flavin-adenine dinucleotide: F32 (≠ Y30), E33 (= E31), K34 (≠ R32), G40 (= G38), A41 (≠ S39), S42 (≠ T40), A45 (≠ H43), A46 (≠ H44), G47 (= G45), M48 (≠ L46), V178 (= V167), S206 (≠ A208), G207 (= G209), W209 (= W211), R307 (= R312)
Sites not aligning to the query:
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
25% identity, 75% coverage: 19:313/392 of query aligns to 21:308/368 of 4yshB
- active site: A45 (≠ H43), M48 (≠ L46), L49 (= L47), Q52 (≠ G50), I262 (≠ V264), L283 (≠ M288), G305 (≠ A310)
- binding flavin-adenine dinucleotide: F32 (≠ Y30), E33 (= E31), K34 (≠ R32), G40 (= G38), A41 (≠ S39), S42 (≠ T40), A45 (≠ H43), A46 (≠ H44), M48 (≠ L46), V178 (= V167), S206 (≠ A208), W209 (= W211), R307 (= R312)
- binding glycine: G249 (= G253), Y251 (≠ I255), Y251 (≠ I255), A264 (≠ G266), R307 (= R312)
Sites not aligning to the query:
- active site: 335, 338
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 332, 334, 335, 336, 337, 338
- binding glycine: 334, 334
Query Sequence
>8500375 FitnessBrowser__Miya:8500375
MEHIAIIGGGGTAAALAHDLILRGFSVAIYERGEFFSGSTGRHHGLLHSGARYAVHDPEA
ARECIEENMILRRLVPQAMEQNEGLFVALDDEDMAYRQRLKDACAATGIPTRDYTPEQAR
SMEPGLTDTLLAAMQVPDATFDAWRLALPFLATARAGGATIHNFTEVIGIDVQGGAVRGL
RLRTLTEDAHGARGREWSAPADMVVNAAGAWAGKVAALAGVHVPIQPGPGVLVAIEGRVT
NMVINRMRKASEGDIIVPQRRLSVLGTSMWLTDDPDHLDIPPEHVQRMVRLCSEMVPACA
DAPIRSAWSAARPLIGNADAARPQEISRTFDCYDHGTRDNVSGLLSIIGGKGMTLRAMAE
KTADIICRLTGRDAPCRTRETPLLPARAFYRS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory