Comparing 8500719 FitnessBrowser__Miya:8500719 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q3JWH7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Burkholderia pseudomallei (strain 1710b) (see paper)
61% identity, 92% coverage: 1:230/249 of query aligns to 1:230/249 of Q3JWH7
3gp5A Crystal structure of phosphoglyceromutase from burkholderia pseudomallei with 3-phosphoglyceric acid and vanadate (see paper)
61% identity, 92% coverage: 1:230/249 of query aligns to 1:230/248 of 3gp5A
3fdzA Crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b with bound 2,3-diphosphoglyceric acid and 3- phosphoglyceric acid (see paper)
61% identity, 92% coverage: 1:230/249 of query aligns to 1:230/230 of 3fdzA
3gp3A Crystal structure of phosphoglyceromutase from burkholderia pseudomallei with 2-phosphoserine (see paper)
61% identity, 92% coverage: 1:229/249 of query aligns to 1:229/229 of 3gp3A
P62707 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Escherichia coli (strain K12) (see 6 papers)
57% identity, 98% coverage: 4:248/249 of query aligns to 6:250/250 of P62707
Sites not aligning to the query:
1e59A E.Coli cofactor-dependent phosphoglycerate mutase complexed with vanadate (see paper)
57% identity, 94% coverage: 4:238/249 of query aligns to 4:238/239 of 1e59A
P18669 Phosphoglycerate mutase 1; BPG-dependent PGAM 1; Phosphoglycerate mutase isozyme B; PGAM-B; EC 5.4.2.11; EC 5.4.2.4 from Homo sapiens (Human) (see 4 papers)
57% identity, 100% coverage: 2:249/249 of query aligns to 4:254/254 of P18669
Sites not aligning to the query:
7xb8B Phosphoglycerate mutase 1 complexed with a covalent inhibitor
57% identity, 98% coverage: 2:245/249 of query aligns to 2:248/249 of 7xb8B
7xb7B Phosphoglycerate mutase 1 complexed with a covalent inhibitor
56% identity, 97% coverage: 2:243/249 of query aligns to 2:246/246 of 7xb7B
1yfkA Crystal structure of human b type phosphoglycerate mutase (see paper)
58% identity, 92% coverage: 2:230/249 of query aligns to 2:233/243 of 1yfkA
5zs8C Acetylation of lysine 100 of phosphoglycerate mutase 1 complexed with kh_ol
58% identity, 92% coverage: 2:230/249 of query aligns to 3:234/240 of 5zs8C
5y65C Phosphoglycerate mutase 1 complexed with a small molecule inhibitor kh2
58% identity, 92% coverage: 2:230/249 of query aligns to 2:233/239 of 5y65C
5y35C Phosphoglycerate mutase 1 complexed with a small molecule inhibitor kh1
58% identity, 92% coverage: 2:230/249 of query aligns to 3:234/237 of 5y35C
5y2uB X-ray structure of phosphoglycerate mutase 1(pgam1) complexed with a small molecule
58% identity, 92% coverage: 2:230/249 of query aligns to 2:233/237 of 5y2uB
5y2iB Phosphoglycerate mutase 1 (pgam1) complexed with its inhibitor pgmi- 004a
58% identity, 92% coverage: 2:230/249 of query aligns to 2:233/233 of 5y2iB
6isnC Phosphoglycerate mutase 1 complexed with a small molecule inhibitor
58% identity, 92% coverage: 2:230/249 of query aligns to 3:234/234 of 6isnC
5zrmC Phosphoglycerate mutase 1 complexed with a small molecule inhibitor in-ac
58% identity, 92% coverage: 2:230/249 of query aligns to 3:234/234 of 5zrmC
7xb9B Phosphoglycerate mutase 1 complexed with a covalent inhibitor
58% identity, 89% coverage: 2:223/249 of query aligns to 2:225/231 of 7xb9B
P00950 Phosphoglycerate mutase 1; PGAM 1; BPG-dependent PGAM 1; MPGM 1; Phosphoglyceromutase 1; EC 5.4.2.11 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 7 papers)
54% identity, 98% coverage: 1:245/249 of query aligns to 1:245/247 of P00950
5pgmE Saccharomyces cerevisiae phosphoglycerate mutase (see paper)
54% identity, 93% coverage: 4:234/249 of query aligns to 3:233/234 of 5pgmE
Sites not aligning to the query:
>8500719 FitnessBrowser__Miya:8500719
MHTLVLLRHGQSAWNLENRFTGWTDVDLSPEGEQEARDAARLLTDEGLTFDVCHTSVLTR
AIRTLYIVQHEMGLSWLPVHKHWRLNERHYGGLQGLDKAETAARFGEEQVFEWRRSYDTP
PPPLPADDPRSPAGDARYAGLAPDVLPASESLKETVARVLPYWHDVIAPQVLAGQRVLVA
AHGNSLRALVMHLDGMTPEAVTKLNIPTGLPLVYTLDGTLRPLAHRYLGDPAVAEAKAKA
VAAQGAARK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory