Comparing 8501223 FitnessBrowser__Miya:8501223 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AFK9 Spermidine/putrescine-binding periplasmic protein; SPBP from Escherichia coli (strain K12) (see 3 papers)
51% identity, 91% coverage: 31:357/358 of query aligns to 21:347/348 of P0AFK9
Sites not aligning to the query:
1poy1 Spermidine/putrescine-binding protein complexed with spermidine (dimer form) (see paper)
52% identity, 89% coverage: 38:357/358 of query aligns to 3:322/323 of 1poy1
7xjnA Structure of vcpotd1 in complex with norspermidine
48% identity, 90% coverage: 35:355/358 of query aligns to 1:320/322 of 7xjnA
4eqbA 1.5 angstrom crystal structure of spermidine/putrescine abc transporter substrate-binding protein potd from streptococcus pneumoniae strain canada mdr_19a in complex with calcium and hepes
39% identity, 87% coverage: 39:350/358 of query aligns to 4:303/323 of 4eqbA
Sites not aligning to the query:
Q9I6J0 Spermidine-binding periplasmic protein SpuE from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
36% identity, 96% coverage: 15:357/358 of query aligns to 5:364/365 of Q9I6J0
Q9I6J1 Putrescine-binding periplasmic protein SpuD from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
35% identity, 95% coverage: 19:357/358 of query aligns to 10:366/367 of Q9I6J1
3ttnA Crystal structures of polyamine receptors spud and spue from pseudomonas aeruginosa (see paper)
36% identity, 82% coverage: 39:331/358 of query aligns to 2:310/335 of 3ttnA
3ttmA Crystal structure of spud in complex with putrescine (see paper)
34% identity, 90% coverage: 35:357/358 of query aligns to 1:341/341 of 3ttmA
7oywA E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88l s247d in complex with spermidine (see paper)
32% identity, 90% coverage: 36:357/358 of query aligns to 1:341/348 of 7oywA
7oyvA E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88a s247d in complex with spermidine (see paper)
32% identity, 90% coverage: 36:357/358 of query aligns to 1:341/341 of 7oyvA
P31133 Putrescine-binding periplasmic protein PotF from Escherichia coli (strain K12) (see 3 papers)
32% identity, 96% coverage: 13:357/358 of query aligns to 12:369/370 of P31133
Sites not aligning to the query:
7oyxB E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s f88y s247d in complex with spermidine (see paper)
31% identity, 90% coverage: 36:357/358 of query aligns to 1:341/347 of 7oyxB
6ye7A E.Coli's putrescine receptor potf complexed with cadaverine (see paper)
31% identity, 90% coverage: 36:357/358 of query aligns to 1:341/341 of 6ye7A
6ye6A E.Coli's putrescine receptor potf complexed with agmatine (see paper)
31% identity, 90% coverage: 36:357/358 of query aligns to 1:341/341 of 6ye6A
6ye0B E.Coli's putrescine receptor potf complexed with putrescine (see paper)
31% identity, 90% coverage: 36:357/358 of query aligns to 1:341/341 of 6ye0B
1a99A Putrescine receptor (potf) from e. Coli (see paper)
31% identity, 90% coverage: 36:357/358 of query aligns to 1:341/341 of 1a99A
6hlyA Structure in p212121 form of the pbp agtb in complex with agropinic acid from a.Tumefacien r10 (see paper)
26% identity, 79% coverage: 50:331/358 of query aligns to 21:290/320 of 6hlyA
Sites not aligning to the query:
4euoA Structure of atu4243-gaba sensor (see paper)
26% identity, 83% coverage: 54:350/358 of query aligns to 21:307/313 of 4euoA
Sites not aligning to the query:
4r75A Structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous sedoheptulose-7-phosphate bound) (see paper)
26% identity, 52% coverage: 104:289/358 of query aligns to 68:253/318 of 4r75A
Sites not aligning to the query:
4r74B Structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous fructose-6-phosphate bound) (see paper)
26% identity, 52% coverage: 104:289/358 of query aligns to 70:255/320 of 4r74B
Sites not aligning to the query:
>8501223 FitnessBrowser__Miya:8501223
MRTKLHAARAALVMVGLALAVLAATLFAGPAVAAEEKVLHVYNWSEYVPQSVLDRFTKET
GIKVVYTTYESNEAMYAKVKLLKGVGYDVVVPSTYFISMMRDDGLLARIDKSKLKNFKNL
SPKVLNQPFDPGNEYSVPYMWGSAGLMVNRKVVDPASITSWNDLNRPEFAGKVILSDDQR
DSMGVALKALGYSVNSTNEAEIKAAYEWLKKLLPAVRVFDVTASKQAFISEEVAAGLIWN
GDAYIAASENENLVYVYPREGVPLWVDSLAIPVGAKHKDNAHKFIDFLLRPDVAKECVEE
YNYSTPNVGAQKILSPELAKSRITSPSDADLKNAEFTNSVGNALEIYEKYWEMLKTGS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory