Comparing 8501746 FitnessBrowser__Miya:8501746 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
6uqnB Crystal structure of r173a variant of cytosolic fumarate hydratase from leishmania major in a complex with fumarate and s-malate (see paper)
40% identity, 93% coverage: 13:174/175 of query aligns to 364:527/532 of 6uqnB
Sites not aligning to the query:
6msnA Crystal structure of cytosolic fumarate hydratase from leishmania major in a complex with inhibitor thiomalate (see paper)
40% identity, 93% coverage: 13:174/175 of query aligns to 364:527/532 of 6msnA
Sites not aligning to the query:
6uoiA Crystal structure of cytosolic fumarate hydratase from leishmania major in a complex with malonate (see paper)
40% identity, 93% coverage: 13:174/175 of query aligns to 367:530/535 of 6uoiA
Sites not aligning to the query:
6unzA Crystal structure of cytosolic fumarate hydratase from leishmania major (see paper)
40% identity, 93% coverage: 13:174/175 of query aligns to 371:534/539 of 6unzA
Sites not aligning to the query:
E9AE57 Fumarate hydratase 2; Fumarase 2; LmFH-2; EC 4.2.1.2 from Leishmania major (see paper)
40% identity, 93% coverage: 13:174/175 of query aligns to 400:563/568 of E9AE57
Sites not aligning to the query:
P14407 Fumarate hydratase class I, anaerobic; D-tartrate dehydratase; Fumarase B; EC 4.2.1.2; EC 4.2.1.81 from Escherichia coli (strain K12) (see paper)
40% identity, 97% coverage: 6:174/175 of query aligns to 363:535/548 of P14407
Sites not aligning to the query:
6msoA Crystal structure of mitochondrial fumarate hydratase from leishmania major in a complex with inhibitor thiomalate (see paper)
36% identity, 85% coverage: 26:174/175 of query aligns to 387:537/540 of 6msoA
Sites not aligning to the query:
Q4QAU9 Fumarate hydratase 1, mitochondrial; Fumarase 1; LmFH-1; EC 4.2.1.2 from Leishmania major (see paper)
36% identity, 85% coverage: 26:174/175 of query aligns to 396:546/549 of Q4QAU9
Sites not aligning to the query:
>8501746 FitnessBrowser__Miya:8501746
MATHHLTTPLTDEAVAQLRSGDVVFLSGTIYTARDAAHRRLAESLDRGEDPPFDLRGAVI
YYVGPSPAPPGRPIGSAGPTTSYRMDSYAPRLHALGLKATIGKGRRNTEVRDALKQHTAV
YLGATGGAGALLSQCITAATVIAYDDLGPEAIRELTVKDFPLLVINDCVGGELYV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory