Comparing ABID97_RS24730 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
5ds9B Crystal structure of fis bound to 27bp DNA f1-8a (aaattagtttgaattttgagctaattt) (see paper)
42% identity, 97% coverage: 1:76/78 of query aligns to 22:97/98 of 5ds9B
1fipA The structure of fis mutant pro61ala illustrates that the kink within the long alpha-helix is not due to the presence of the proline residue (see paper)
42% identity, 91% coverage: 6:76/78 of query aligns to 2:72/73 of 1fipA
Sites not aligning to the query:
P10577 DNA-binding transcriptional regulator NtrC; Nitrogen regulation protein NR(I); Nitrogen regulator I; NRI from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
42% identity, 87% coverage: 6:73/78 of query aligns to 404:472/484 of P10577
>ABID97_RS24730
MSKKHIEDCVRTSLDSYFRDLRGTEPDGMYEMLVRVVEKPLLDVVMTRAEGNQSKAAQWL
GLNRNTLRKKLVEHKLLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.