SitesBLAST
Comparing AO353_01980 FitnessBrowser__pseudo3_N2E3:AO353_01980 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
25% identity, 97% coverage: 5:317/323 of query aligns to 2:304/309 of 4zrnA
- active site: T117 (= T129), G119 (≠ T131), A120 (= A132), Y143 (= Y145), K147 (= K149), Y181 (vs. gap), G185 (= G179)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ L15), D31 (≠ R36), N32 (= N37), S34 (≠ T38), S35 (≠ H39), G36 (≠ A40), S51 (≠ L54), I52 (≠ A55), L73 (≠ A73), A74 (= A74), A75 (= A75), T92 (≠ V94), S115 (≠ I117), S116 (= S118), Y143 (= Y145), K147 (= K149), Y170 (≠ P172), V173 (≠ I175)
- binding uridine-5'-diphosphate-glucose: T117 (= T129), G119 (≠ T131), A120 (= A132), Y143 (= Y145), N172 (≠ L174), G185 (= G179), V186 (= V180), H201 (≠ L197), F203 (= F199), Y208 (≠ N204), R210 (= R206), V244 (≠ T242), R267 (≠ L262), D270 (≠ W265)
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
30% identity, 70% coverage: 3:228/323 of query aligns to 1:234/308 of 6wj9B
- active site: A119 (≠ S119), A120 (≠ I120), A121 (≠ K121), F144 (≠ Y145), K148 (= K149)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), F12 (= F14), I13 (≠ L15), D32 (≠ P34), D33 (≠ V35), S35 (≠ N37), T36 (= T38), G37 (vs. gap), D55 (= D53), A56 (≠ L54), L75 (≠ A73), A76 (= A74), A77 (= A75), S94 (≠ K93), A117 (≠ I117), A119 (≠ S119), F144 (≠ Y145), K148 (= K149), F171 (≠ P172), F172 (≠ V173), I174 (= I175)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (≠ M80), N173 (≠ L174), G187 (≠ N183), V188 (≠ F184), F192 (≠ M188), T203 (≠ P198), L204 (vs. gap), F205 (= F199), R212 (= R206)
Sites not aligning to the query:
Q9R1J0 Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating; EC 1.1.1.170 from Mus musculus (Mouse) (see 3 papers)
24% identity, 98% coverage: 2:317/323 of query aligns to 25:355/362 of Q9R1J0
- V53 (≠ L33) to D: in bpa; does not rescue the yeast mutant lacking the ortholog erg26
- A94 (= A74) to T: in bpa; does not rescue the yeast mutant lacking the ortholog erg26
- P98 (= P87) to L: in str; does not rescue the yeast mutant lacking the ortholog erg26
- V109 (= V94) to M: in str; rescues the yeast mutant lacking the ortholog erg26
Sites not aligning to the query:
- 103:362 natural variant: Missing (in bpa)
- 359:362 Prevents secretion from ER
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
30% identity, 70% coverage: 4:228/323 of query aligns to 1:233/307 of 6wjaA
- active site: A118 (≠ S119), A119 (≠ I120), A120 (≠ K121), F143 (≠ Y145), K147 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ L15), D31 (≠ P34), D32 (≠ V35), S34 (≠ N37), T35 (= T38), G36 (vs. gap), A55 (≠ L54), L74 (≠ A73), A75 (= A74), A76 (= A75), S93 (≠ K93), F143 (≠ Y145), K147 (= K149), F170 (≠ P172), F171 (≠ V173), I173 (= I175)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (≠ M80), A120 (≠ K121), N172 (≠ L174), G186 (≠ N183), V187 (≠ F184), F191 (≠ M188), T202 (≠ P198), F204 (= F199), R211 (= R206)
Sites not aligning to the query:
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
25% identity, 98% coverage: 6:322/323 of query aligns to 3:313/313 of 6bwlA
- active site: T122 (≠ S119), C123 (≠ I120), M124 (≠ K121), Y147 (= Y145), K151 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ L15), D31 (≠ P34), N32 (vs. gap), L33 (vs. gap), N35 (≠ R36), S36 (≠ N37), D57 (= D57), I58 (≠ T58), L79 (≠ A73), A80 (= A74), A81 (= A75), I83 (≠ V77), M120 (≠ I117), K151 (= K149), N176 (≠ L174), T177 (≠ I175)
- binding uridine-5'-diphosphate: N176 (≠ L174), G189 (= G179), V190 (= V180), N205 (≠ P198), I206 (vs. gap), Y207 (≠ F199), Q212 (≠ N204), R214 (= R206), I250 (≠ T242), E275 (≠ L279)
6x3bA Structure of rmd from pseudomonas aeruginosa complexed with NADPH
25% identity, 77% coverage: 4:251/323 of query aligns to 6:247/300 of 6x3bA
- active site: S108 (= S119), G109 (≠ I120), D110 (≠ K121), Y134 (= Y145), K138 (= K149)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G10), S14 (≠ T12), G15 (= G13), F16 (= F14), V17 (≠ L15), D42 (≠ A40), L43 (≠ Q41), L63 (≠ A73), A64 (= A74), G65 (≠ A75), T67 (≠ V77), Y134 (= Y145), K138 (= K149), H164 (≠ I175), Q169 (≠ V180)
6x3bB Structure of rmd from pseudomonas aeruginosa complexed with NADPH
25% identity, 77% coverage: 4:251/323 of query aligns to 2:243/297 of 6x3bB
- active site: S104 (= S119), G105 (≠ I120), D106 (≠ K121), Y130 (= Y145), K134 (= K149)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), S10 (≠ T12), G11 (= G13), F12 (= F14), V13 (≠ L15), D38 (≠ A40), L39 (≠ Q41), L59 (≠ A73), A60 (= A74), G61 (≠ A75), T63 (≠ V77), I102 (= I117), Y130 (= Y145), K134 (= K149), H160 (≠ I175), Q165 (≠ V180)
- binding pyrophosphate 2-: D106 (≠ K121), R199 (= R206)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
27% identity, 65% coverage: 6:215/323 of query aligns to 3:222/314 of 6zldA
- active site: T126 (≠ S119), S127 (≠ I120), S128 (≠ K121), Y149 (= Y145), K153 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ L15), D32 (vs. gap), H33 (vs. gap), F34 (vs. gap), I35 (vs. gap), K43 (≠ P34), D62 (≠ L54), I63 (≠ A55), L81 (≠ A73), A82 (= A74), A83 (= A75), I124 (= I117), T126 (≠ S119), K153 (= K149), Y176 (≠ P172), T178 (≠ L174), R185 (≠ K181), M188 (vs. gap)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (≠ V77), R88 (≠ M80), T126 (≠ S119), S127 (≠ I120), S128 (≠ K121), Y149 (= Y145), F177 (≠ V173), T178 (≠ L174), R185 (≠ K181), M188 (vs. gap), A189 (vs. gap), R192 (≠ S186), T204 (≠ P198), F206 (= F199), Q211 (≠ N204), R213 (= R206)
Sites not aligning to the query:
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
27% identity, 65% coverage: 6:215/323 of query aligns to 3:222/314 of 6zl6A
- active site: T126 (≠ S119), S127 (≠ I120), S128 (≠ K121), Y149 (= Y145), K153 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ L15), D32 (vs. gap), H33 (vs. gap), F34 (vs. gap), I35 (vs. gap), K43 (≠ P34), D62 (≠ L54), I63 (≠ A55), L81 (≠ A73), A82 (= A74), A83 (= A75), I124 (= I117), T126 (≠ S119), K153 (= K149), Y176 (≠ P172), T178 (≠ L174), V179 (≠ I175), R185 (≠ K181), M188 (vs. gap)
- binding uridine-5'-diphosphate: T178 (≠ L174), A189 (vs. gap), R192 (≠ S186), T204 (≠ P198), F206 (= F199), Q211 (≠ N204), R213 (= R206)
Sites not aligning to the query:
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
27% identity, 65% coverage: 6:215/323 of query aligns to 3:222/321 of 6zllA
- active site: T126 (≠ S119), S127 (≠ I120), S128 (≠ K121), Y149 (= Y145), K153 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ L15), D32 (vs. gap), H33 (vs. gap), F34 (vs. gap), I35 (vs. gap), K43 (≠ P34), D62 (≠ L54), I63 (≠ A55), L81 (≠ A73), A82 (= A74), A83 (= A75), I124 (= I117), T126 (≠ S119), Y149 (= Y145), K153 (= K149), Y176 (≠ P172), V179 (≠ I175), R185 (≠ K181), M188 (vs. gap)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (≠ V77), V87 (≠ I79), R88 (≠ M80), T126 (≠ S119), S127 (≠ I120), Y149 (= Y145), T178 (≠ L174), R185 (≠ K181), A189 (vs. gap), R192 (≠ S186), T204 (≠ P198), F206 (= F199), Q211 (≠ N204), R213 (= R206)
Sites not aligning to the query:
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: 250, 276
4id9A Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
34% identity, 51% coverage: 6:171/323 of query aligns to 2:158/321 of 4id9A
- active site: S106 (= S119), Y132 (= Y145), K136 (= K149)
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), R10 (≠ F14), V11 (≠ L15), D30 (≠ P34), L31 (≠ V35), R32 (= R36), S44 (≠ Q50), L45 (≠ I51), L64 (≠ A73), A66 (= A75), V81 (= V94), S106 (= S119), Y132 (= Y145), K136 (= K149)
Sites not aligning to the query:
4id9B Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
34% identity, 51% coverage: 6:171/323 of query aligns to 3:159/328 of 4id9B
- active site: S107 (= S119), Y133 (= Y145), K137 (= K149)
- binding nicotinamide-adenine-dinucleotide: G10 (= G13), R11 (≠ F14), V12 (≠ L15), D31 (≠ P34), L32 (≠ V35), S45 (≠ Q50), L46 (≠ I51), L65 (≠ A73), A67 (= A75), V82 (= V94), Y133 (= Y145), K137 (= K149)
Sites not aligning to the query:
3eheA Crystal structure of udp-glucose 4 epimerase (gale-1) from archaeoglobus fulgidus
23% identity, 97% coverage: 6:319/323 of query aligns to 2:286/290 of 3eheA
- active site: T111 (≠ S119), S112 (≠ I120), T113 (≠ K121), Y135 (= Y145), K139 (= K149)
- binding nicotinamide-adenine-dinucleotide: G6 (= G10), G9 (= G13), F10 (= F14), I11 (≠ L15), D29 (≠ L33), N30 (≠ P34), L31 (≠ V35), S32 (≠ R36), S33 (≠ N37), G34 (≠ T38), D49 (= D53), L50 (= L54), I68 (≠ A73), A69 (= A74), A70 (= A75), T109 (≠ I117), Y135 (= Y145), K139 (= K149), F162 (≠ P172), A163 (≠ V173), N164 (≠ L174), V165 (≠ I175)
P27830 dTDP-glucose 4,6-dehydratase 2; EC 4.2.1.46 from Escherichia coli (strain K12) (see 2 papers)
25% identity, 97% coverage: 6:318/323 of query aligns to 4:332/355 of P27830
- FI 12:13 (≠ FL 14:15) binding
- DKLT 33:36 (≠ VRNT 35:38) binding
- DI 59:60 (≠ DT 57:58) binding
- T100 (≠ V94) binding
- D135 (≠ I120) active site, Proton donor
- E136 (≠ K121) active site, Proton acceptor
- Y160 (= Y145) active site, Proton acceptor
- YSASK 160:164 (≠ YGITK 145:149) binding
- N190 (≠ I175) binding
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
26% identity, 65% coverage: 6:215/323 of query aligns to 3:222/314 of 6zljA
- active site: T126 (≠ S119), S127 (≠ I120), S128 (≠ K121), F149 (≠ Y145), K153 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ L15), D32 (vs. gap), H33 (vs. gap), F34 (vs. gap), I35 (vs. gap), K43 (≠ P34), D62 (≠ L54), I63 (≠ A55), L81 (≠ A73), A82 (= A74), A83 (= A75), I124 (= I117), T126 (≠ S119), K153 (= K149), Y176 (≠ P172), T178 (≠ L174), V179 (≠ I175), R185 (≠ K181), M188 (vs. gap)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (≠ V77), R88 (≠ M80), T126 (≠ S119), S127 (≠ I120), S128 (≠ K121), F149 (≠ Y145), F177 (≠ V173), T178 (≠ L174), R185 (≠ K181), M188 (vs. gap), A189 (vs. gap), R192 (≠ S186), T204 (≠ P198), F206 (= F199), Q211 (≠ N204), R213 (= R206)
Sites not aligning to the query:
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: 250, 276
6kvcA Moee5 in complex with udp-glucose and NAD (see paper)
23% identity, 96% coverage: 6:315/323 of query aligns to 3:292/299 of 6kvcA
- active site: S109 (= S119), S110 (≠ I120), S111 (≠ K121), Y132 (= Y145), K136 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ L15), D31 (≠ P34), R32 (≠ V35), R33 (= R36), D46 (≠ L54), L47 (≠ A55), L65 (≠ A73), A66 (= A74), A67 (= A75), P69 (≠ V77), A107 (≠ I117), S109 (= S119), K136 (= K149), F161 (≠ P172), T163 (≠ L174), V164 (≠ I175), R170 (≠ K181), M173 (vs. gap)
- binding uridine-5'-diphosphate-glucose: P69 (≠ V77), R72 (≠ M80), S109 (= S119), S110 (≠ I120), Y132 (= Y145), T163 (≠ L174), M173 (vs. gap), F174 (= F184), R177 (vs. gap), E189 (≠ P198), I190 (vs. gap), Y191 (≠ F199), Q196 (≠ N204), R198 (= R206), D260 (≠ R268)
7k3pA The structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni
30% identity, 53% coverage: 6:177/323 of query aligns to 4:180/329 of 7k3pA
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (≠ F14), I13 (≠ L15), D32 (≠ N37), N33 (≠ T38), S35 (≠ A40), G37 (≠ F42), D57 (≠ A63), L58 (= L64), F79 (≠ A73), A80 (= A74), I83 (≠ V77), N98 (≠ K93), Y147 (= Y145), K151 (= K149), Y175 (≠ P172), N177 (≠ L174), V178 (≠ I175)
1bxkB Dtdp-glucose 4,6-dehydratase from e. Coli
25% identity, 97% coverage: 6:318/323 of query aligns to 4:326/344 of 1bxkB
- active site: S125 (≠ G110), T134 (≠ S119), D135 (≠ I120), E136 (≠ K121), S158 (≠ D143), Y160 (= Y145), S161 (≠ G146), K164 (= K149)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), F12 (= F14), I13 (≠ L15), D33 (≠ V35), K34 (≠ R36), L35 (≠ N37), T36 (= T38), A38 (= A40), G39 (vs. gap), D59 (= D57), I60 (≠ T58), L81 (≠ A73), A83 (= A75), T100 (≠ V94), I132 (= I117), S133 (= S118), T134 (≠ S119), K164 (= K149), C187 (≠ P172)
6kv9A Moee5 in complex with udp-glucuronic acid and NAD (see paper)
23% identity, 96% coverage: 6:315/323 of query aligns to 3:293/299 of 6kv9A
- active site: S110 (= S119), S111 (≠ I120), S112 (≠ K121), Y133 (= Y145), K137 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ L15), D31 (≠ P34), R32 (≠ V35), R33 (= R36), D47 (= D57), L48 (≠ T58), L66 (≠ A73), A67 (= A74), A68 (= A75), P70 (≠ V77), C85 (≠ V94), A108 (≠ I117), S109 (= S118), K137 (= K149), F162 (≠ P172), T164 (≠ L174), V165 (≠ I175), R171 (≠ K181), M174 (vs. gap)
- binding uridine-5'-diphosphate-glucuronic acid: P70 (≠ V77), R73 (≠ M80), S110 (= S119), S111 (≠ I120), Y133 (= Y145), T164 (≠ L174), R171 (≠ K181), M174 (vs. gap), F175 (= F184), R178 (vs. gap), E190 (≠ P198), I191 (vs. gap), Y192 (≠ F199), Q197 (≠ N204), R199 (= R206), V235 (≠ T242), D261 (≠ R268)
6pnlA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
22% identity, 98% coverage: 3:320/323 of query aligns to 15:326/336 of 6pnlA
- active site: S133 (= S119), C135 (≠ T129), G136 (= G130), Y159 (= Y145), K163 (= K149)
- binding nicotinamide-adenine-dinucleotide: G22 (= G10), G25 (= G13), C26 (≠ F14), D46 (≠ P34), N47 (≠ V35), L48 (≠ R36), S49 (≠ N37), S50 (≠ T38), S51 (≠ H39), D68 (= D57), I69 (≠ T58), L89 (≠ A73), A91 (= A75), F93 (≠ I79), V108 (= V94), S131 (≠ I117), S133 (= S119), Y159 (= Y145), K163 (= K149), F186 (≠ P172), N188 (≠ L174), V189 (≠ I175), R200 (vs. gap)
- binding uridine-5'-diphosphate: N188 (≠ L174), N201 (vs. gap), V202 (= V180), F206 (= F184), P217 (= P198), I218 (≠ F199), T219 (vs. gap), R226 (= R206), V262 (≠ T242), R285 (= R282)
Query Sequence
>AO353_01980 FitnessBrowser__pseudo3_N2E3:AO353_01980
MSAETILVTGGTGFLGAALVRQLATMDSCALVLPVRNTHAQFSPVARVLQIDDLAADTDW
RQALSGVDKVVHAAARVHIMKETSADPLTEFRKVNVDGTLSLARQSVAAGVKRFIFISSI
KVNGERTGTGTAYCADDVPAPVDPYGITKMEAEQGLKELASNSSMEVVIIRPVLIYGPGV
KANFLSMMNWLSKGVPLPFGAIHNRRSLVALDNLIDLIITCLNHPAAANQTFLVSDGQDV
STTELLRKTSDALHHPACLIPLPVWIMRVLAVSLGKQALFQRLFDSLQVDISKNKQLLDW
TPPMSLEQSLAKTVQHFLESTKS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory