Comparing AO353_03400 FitnessBrowser__pseudo3_N2E3:AO353_03400 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P32140 Sulfoquinovose isomerase; SQ isomerase; Sulfoquinovose-sulfofructose isomerase; SQ-SF isomerase; EC 5.3.1.31 from Escherichia coli (strain K12) (see paper)
47% identity, 97% coverage: 10:417/419 of query aligns to 2:410/413 of P32140
7ag4D Crystal structure of active site mutant of sq isomerase (yihs-h248a) from salmonella enterica in complex with sulfofructose (sf) (see paper)
46% identity, 97% coverage: 10:417/419 of query aligns to 14:422/425 of 7ag4D
2zblA Functional annotation of salmonella enterica yihs-encoded protein (see paper)
46% identity, 97% coverage: 10:417/419 of query aligns to 2:410/416 of 2zblA
8h1lB Crystal structure of glucose-2-epimerase in complex with d-glucitol from runella slithyformis runsl_4512 (see paper)
23% identity, 53% coverage: 44:265/419 of query aligns to 41:283/423 of 8h1lB
Sites not aligning to the query:
>AO353_03400 FitnessBrowser__pseudo3_N2E3:AO353_03400
MNTAPPAFSSWLNAPAHQQWLADEGLRLLAFAKASKLPEGFGNLDEHGQLPADAQAHTMN
TARMTHSFAMAHIQGLPGFAELVDHGINALNGLLRDAEFGGWFAAPDHRDGDTGKAAYLH
AFVALAASSAVIAQRPGAEALLNDAIAIIEQHFWSEEEGAMRESFNRDWSEEEPYRGANS
NMHATEAFLALADVTQDSRWLNRALRIVERVIHRHAASNDHLVVEHFDRDWQPLRDYNQA
NPADHFRPYGTTPGHGFEWSRLLLHLEAARGQAGMLTPGWLLSDAQQLFANNCLHGWDVD
GAPGIVYTLDWDNRPVVRQRLHWVHCEASAAASVLLKRTGEAQYETWYRRFWEFSDRCLI
DRIHGSWHHELDPQNRPSTEIWGGKPDLYHAWQAVLIPRLPLAPSMASALAQGSVSVLM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory