SitesBLAST
Comparing AO353_21000 FitnessBrowser__pseudo3_N2E3:AO353_21000 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3jynA Crystal structures of pseudomonas syringae pv. Tomato dc3000 quinone oxidoreductase complexed with NADPH (see paper)
49% identity, 100% coverage: 1:325/326 of query aligns to 1:324/325 of 3jynA
- active site: N41 (= N41), F42 (≠ Y42), I43 (≠ A43), D44 (= D44), T45 (= T45), Y46 (= Y46), A63 (≠ V62), E64 (= E63), L123 (≠ M124), S320 (= S321)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F42 (≠ Y42), T127 (= T128), Y130 (= Y131), A148 (= A149), G151 (= G152), G152 (= G153), V153 (= V154), S173 (= S174), K177 (= K178), Y192 (= Y193), G216 (≠ S217), F238 (≠ V239), G239 (= G240), A241 (= A242), S242 (= S243), T265 (≠ A266), L266 (= L267), R315 (= R316)
P28304 Quinone oxidoreductase 1; NADPH:quinone reductase 1; Zeta-crystallin homolog protein; EC 1.6.5.5 from Escherichia coli (strain K12) (see paper)
46% identity, 100% coverage: 1:325/326 of query aligns to 1:326/327 of P28304
1qorA Crystal structure of escherichia coli quinone oxidoreductase complexed with NADPH (see paper)
46% identity, 99% coverage: 2:325/326 of query aligns to 1:325/326 of 1qorA
- active site: N40 (= N41), F41 (≠ Y42), I42 (≠ A43), Y45 (= Y46), T62 (≠ V62), E63 (= E63)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F41 (≠ Y42), Y45 (= Y46), T126 (= T128), Y129 (= Y131), G150 (= G152), G151 (= G153), V152 (= V154), V171 (= V173), G172 (≠ S174), K176 (= K178), Y191 (= Y193), S215 (= S217), F237 (≠ V239), S240 (≠ A242), S241 (= S243), S264 (≠ A266), R316 (= R316)
4rvuA The native structure of mycobacterial rv1454c complexed with NADPH (see paper)
44% identity, 99% coverage: 4:325/326 of query aligns to 4:328/329 of 4rvuA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F42 (≠ Y42), Y46 (= Y46), L125 (≠ M124), T129 (= T128), Y132 (= Y131), A150 (= A149), G153 (= G152), G154 (= G153), V155 (= V154), S175 (= S174), K179 (= K178), Y194 (= Y193), G220 (≠ S217), F242 (≠ V239), G243 (= G240), A245 (= A242), S246 (= S243), L270 (= L267), E317 (= E314), R319 (= R316)
3qwbA Crystal structure of saccharomyces cerevisiae zeta-crystallin-like quinone oxidoreductase zta1 complexed with NADPH (see paper)
42% identity, 99% coverage: 3:326/326 of query aligns to 6:328/330 of 3qwbA
- active site: N44 (= N41), Y45 (= Y42), I46 (≠ A43), Y49 (= Y46), R65 (≠ V62), E66 (= E63)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y45 (= Y42), Y49 (= Y46), Q128 (≠ R125), T131 (= T128), F135 (≠ L132), A152 (= A149), G155 (= G152), G156 (= G153), V157 (= V154), A176 (≠ V173), S177 (= S174), K181 (= K178), S220 (= S217), V221 (= V218), F242 (≠ V239), A245 (= A242), Q268 (≠ A266), R318 (= R316)
O74489 Probable quinone oxidoreductase; NADPH:quinone reductase; EC 1.6.5.5 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
37% identity, 98% coverage: 5:325/326 of query aligns to 6:321/329 of O74489
- S191 (= S194) modified: Phosphoserine
2eihA Crystal structure of NAD-dependent alcohol dehydrogenase
30% identity, 99% coverage: 3:326/326 of query aligns to 2:342/343 of 2eihA
- active site: N40 (= N41), H41 (≠ Y42), L42 (≠ A43), W45 (≠ Y46), A63 (≠ V62), D64 (≠ E63), C93 (≠ T92), C96 (vs. gap), C99 (vs. gap), C107 (vs. gap), Q111 (vs. gap), L149 (≠ M124), T153 (= T128), K337 (≠ S321)
- binding zinc ion: C96 (vs. gap), C99 (vs. gap), C107 (vs. gap)
1yb5A Crystal structure of human zeta-crystallin with bound NADP
28% identity, 96% coverage: 1:313/326 of query aligns to 2:310/324 of 1yb5A
- active site: N43 (= N41), P44 (≠ Y42), V45 (≠ A43), Y48 (= Y46), S66 (≠ V62), D67 (≠ E63), I126 (≠ M124)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: P44 (≠ Y42), Y48 (= Y46), I126 (≠ M124), T130 (= T128), H150 (= H148), G151 (≠ A149), S153 (≠ A151), G154 (= G152), G155 (= G153), V156 (= V154), A175 (≠ V173), G176 (≠ S174), H195 (≠ Y193), L220 (≠ V218), N224 (≠ T222), V241 (= V239), T265 (≠ A268)
Sites not aligning to the query:
Q08257 Quinone oxidoreductase; NADPH:quinone reductase; Zeta-crystallin; EC 1.6.5.5 from Homo sapiens (Human) (see paper)
28% identity, 96% coverage: 1:313/326 of query aligns to 7:315/329 of Q08257
6lhrC Crystal structure of the complex between vesicle amine transport-1 and NADP (see paper)
29% identity, 91% coverage: 30:325/326 of query aligns to 33:341/344 of 6lhrC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: F45 (≠ Y42), T130 (= T128), M151 (≠ A149), G154 (= G152), G155 (= G153), V156 (= V154), A176 (≠ V173), S177 (= S174), K180 (= K178), Y195 (= Y193), Y240 (≠ V239), F281 (vs. gap), H282 (vs. gap), L283 (vs. gap), K332 (≠ R316), N334 (≠ T318)
Q99536 Synaptic vesicle membrane protein VAT-1 homolog; EC 1.-.-.- from Homo sapiens (Human)
29% identity, 91% coverage: 30:325/326 of query aligns to 78:386/393 of Q99536
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
Q53FA7 Quinone oxidoreductase PIG3; NADPH:quinone reductase PIG3; Tumor protein p53-inducible protein 3; Protein PIG3; p53-induced gene 3 protein; EC 1.6.5.5 from Homo sapiens (Human) (see 2 papers)
29% identity, 98% coverage: 4:324/326 of query aligns to 3:328/332 of Q53FA7
- R41 (≠ Y42) binding
- Y51 (= Y52) mutation to A: Loss of enzyme activity.; mutation to F: Increased enzyme activity.
- 148:154 (vs. 149:155, 57% identical) binding
- S151 (≠ G152) mutation to V: Loss of enzyme activity.
- GSQKK 173:177 (≠ STEVK 174:178) binding
- M180 (≠ I181) to K: in a breast cancer sample; somatic mutation; dbSNP:rs899619458
- Y192 (= Y193) binding
- SLL 264:266 (≠ TRP 263:265) binding
- N322 (≠ T318) binding
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
2obyA Crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3)
29% identity, 98% coverage: 4:324/326 of query aligns to 5:330/334 of 2obyA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: N42 (= N41), R43 (≠ Y42), E125 (≠ M124), T129 (= T128), S153 (≠ G152), G154 (= G153), V155 (= V154), A174 (≠ V173), G175 (≠ S174), K179 (= K178), Y194 (= Y193), I219 (≠ V218), Y240 (≠ V239), M243 (≠ A242), L267 (≠ R264), L268 (≠ P265), M319 (≠ L313)
3tqhA Structure of the quinone oxidoreductase from coxiella burnetii (see paper)
31% identity, 99% coverage: 3:326/326 of query aligns to 4:316/317 of 3tqhA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: P43 (≠ Y42), K47 (≠ Y46), T136 (= T128), A156 (= A149), A158 (= A151), G159 (= G152), G160 (= G153), V161 (= V154), A180 (≠ V173), S181 (= S174), N184 (≠ K178), Y199 (= Y193), L218 (≠ S217), V219 (= V218), V240 (= V239), L262 (≠ D269), L263 (≠ Y270), K264 (≠ I271), G306 (≠ R316), H307 (≠ K317), V308 (≠ T318)
P12311 Alcohol dehydrogenase; ADH-T; EC 1.1.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
30% identity, 80% coverage: 16:276/326 of query aligns to 13:301/337 of P12311
- C38 (≠ N41) mutation to S: No activity.
- T40 (≠ A43) mutation to A: No activity.; mutation to S: Little decrease in activity.
- H43 (≠ Y46) mutation to A: No activity.; mutation to R: Higher level of activity at pH 9.
5k1sA Crystal structure of aibc (see paper)
29% identity, 99% coverage: 3:325/326 of query aligns to 16:355/358 of 5k1sA
- active site: C54 (≠ N41), Y55 (= Y42), H56 (≠ A43), I59 (≠ Y46), E77 (= E63), C106 (vs. gap), C109 (vs. gap), C112 (vs. gap), C120 (vs. gap), N124 (vs. gap), C163 (≠ M124), T167 (= T128), R351 (≠ S321)
- binding zinc ion: C54 (≠ N41), H76 (≠ V62), C109 (vs. gap), C112 (vs. gap), C120 (vs. gap), C163 (≠ M124)
P96202 Phenolphthiocerol/phthiocerol polyketide synthase subunit C; (Phenol)carboxyphthiodiolenone synthase subunit C; Beta-ketoacyl-acyl-carrier-protein synthase I; Phthiocerol synthesis polyketide synthase type I PpsC; EC 2.3.1.292 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
29% identity, 99% coverage: 4:326/326 of query aligns to 1458:1780/2188 of P96202
Sites not aligning to the query:
- 959 H→F: Lack of dehydration reaction.
- 2105 modified: O-(pantetheine 4'-phosphoryl)serine; S→A: Lack of phosphopantetheinylation.
5bp4R Mycocerosic acid synthase (see paper)
30% identity, 93% coverage: 24:326/326 of query aligns to 320:621/637 of 5bp4R
- binding nadp nicotinamide-adenine-dinucleotide phosphate: F338 (≠ Y42), R347 (≠ T51), T423 (= T128), S444 (≠ A149), G447 (= G152), G448 (= G153), V449 (= V154), G469 (≠ S174), R473 (≠ K178), S488 (≠ Y193), R489 (≠ S194), I534 (≠ V239), K536 (≠ T241), D560 (= D273), G609 (≠ E314), H613 (≠ T318)
5bp4L Mycocerosic acid synthase (see paper)
30% identity, 93% coverage: 24:326/326 of query aligns to 342:643/897 of 5bp4L
- binding nadp nicotinamide-adenine-dinucleotide phosphate: F360 (≠ Y42), R369 (≠ T51), T445 (= T128), S466 (≠ A149), G469 (= G152), V471 (= V154), G491 (≠ S174), R495 (≠ K178), S510 (≠ Y193), R511 (≠ S194), I556 (≠ V239), V581 (≠ A272), G631 (≠ E314), H635 (≠ T318)
5bp4A Mycocerosic acid synthase (see paper)
30% identity, 93% coverage: 24:326/326 of query aligns to 547:848/1102 of 5bp4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: F565 (≠ Y42), S671 (≠ A149), G674 (= G152), V676 (= V154), A695 (≠ V173), G696 (≠ S174), R700 (≠ K178), S715 (≠ Y193), R716 (≠ S194), I761 (≠ V239), V786 (≠ A272), L788 (vs. gap), G836 (≠ E314), H840 (≠ T318)
Sites not aligning to the query:
Query Sequence
>AO353_21000 FitnessBrowser__pseudo3_N2E3:AO353_21000
MAKAVRFYETGGPDVLRYEEVDVGEPGPGQVRLRHVAVGLNYADTYFRNGTYPIPMPNGM
GVEASGVVQAIGEGVTNVQVGDRVTYTGFLNTLGAYSTERLIPAAPLIKLPETISFETAA
AMTMRGLTSSYLMRRIYDFKAGDSILLHAAAGGVGLIVSQWAKLLGLTVIGTVSTEVKGE
IARAHGCDHVINYSHEDVAQRVRELTDGVGVNVVFDSVGKNTFMGSLDSLKRRGLMVCVG
TASGPIPAFDPVLLAMKGSLFMTRPALADYIADPAEKAALAGELFDLVGSGRIKIEINQH
YALQDAVQAHRDLESRKTTGSSIFVI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory