SitesBLAST
Comparing AO353_21305 FitnessBrowser__pseudo3_N2E3:AO353_21305 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
30% identity, 56% coverage: 9:205/352 of query aligns to 53:253/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ I29), G75 (= G31), S76 (= S33), G77 (≠ S34), T78 (≠ K35), G79 (≠ A36), L80 (≠ F37), A83 (≠ R40), C84 (≠ E41), P137 (= P91), G138 (≠ P92), E139 (≠ S93), A142 (= A98), T143 (= T99), G146 (= G102), N147 (≠ M103), S149 (≠ A105), T150 (≠ A106), A152 (≠ L108), G153 (≠ S109), E203 (≠ F159), G204 (= G160), I209 (= I165)
Sites not aligning to the query:
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
25% identity, 84% coverage: 55:348/352 of query aligns to 96:453/454 of 8jdvA
- binding 2-Ketohexanoic acid: R317 (≠ L246), W321 (vs. gap), H368 (≠ N268), H375 (≠ P275), H413 (= H312)
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ E96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), W321 (vs. gap), Y322 (vs. gap), E412 (≠ S311), H413 (= H312), N449 (= N344)
- binding manganese (ii) ion: H368 (≠ N268), H375 (≠ P275), E412 (≠ S311)
Sites not aligning to the query:
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
24% identity, 84% coverage: 55:348/352 of query aligns to 96:454/455 of 8jdpA
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ E96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), H369 (≠ N268), E413 (≠ S311), N450 (= N344)
- binding deaminohydroxyvaline: R319 (vs. gap), H414 (= H312)
Sites not aligning to the query:
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
25% identity, 84% coverage: 55:348/352 of query aligns to 96:453/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (vs. gap), W322 (vs. gap), H369 (≠ N268), H376 (≠ P275), H413 (= H312)
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ E96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), W322 (vs. gap), E412 (≠ S311), H413 (= H312), N449 (= N344)
- binding manganese (ii) ion: H369 (≠ N268), H376 (≠ P275), E412 (≠ S311)
Sites not aligning to the query:
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
25% identity, 84% coverage: 55:348/352 of query aligns to 96:453/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (vs. gap), W322 (vs. gap), S336 (≠ F253), H369 (≠ N268), H376 (≠ P275), H413 (= H312)
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ E96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), E412 (≠ S311), N449 (= N344)
- binding manganese (ii) ion: H369 (≠ N268), H376 (≠ P275), E412 (≠ S311)
Sites not aligning to the query:
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
25% identity, 84% coverage: 55:348/352 of query aligns to 96:455/456 of 8jdrA
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ E96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), Y324 (vs. gap), H370 (≠ N268), E414 (≠ S311), N451 (= N344)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (vs. gap), W323 (vs. gap), H415 (= H312)
Sites not aligning to the query:
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
25% identity, 84% coverage: 55:348/352 of query aligns to 96:455/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (vs. gap), W323 (vs. gap), H370 (≠ N268), H415 (= H312)
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ E96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), H370 (≠ N268), E414 (≠ S311), N451 (= N344)
Sites not aligning to the query:
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
25% identity, 84% coverage: 55:348/352 of query aligns to 96:455/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (vs. gap), W323 (vs. gap), H415 (= H312)
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ E96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), Y324 (vs. gap), H370 (≠ N268), E414 (≠ S311), N451 (= N344)
Sites not aligning to the query:
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
25% identity, 84% coverage: 55:348/352 of query aligns to 96:455/456 of 8jdnA
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ E96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), H370 (≠ N268), E414 (≠ S311), N451 (= N344)
- binding (2R)-2-oxidanylpentanoic acid: R319 (vs. gap), W323 (vs. gap), H415 (= H312)
Sites not aligning to the query:
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
25% identity, 84% coverage: 55:348/352 of query aligns to 96:455/456 of 8jdgA
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ E96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), H370 (≠ N268), E414 (≠ S311), N451 (= N344)
- binding (2R)-2-oxidanylbutanoic acid: R319 (vs. gap), H415 (= H312)
Sites not aligning to the query:
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
25% identity, 84% coverage: 55:348/352 of query aligns to 96:455/456 of 8jdbA
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ E96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), Y324 (vs. gap), H370 (≠ N268), E414 (≠ S311), N451 (= N344)
- binding (2R)-2-oxidanyloctanoic acid: R319 (vs. gap), W323 (vs. gap), H415 (= H312)
Sites not aligning to the query:
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
25% identity, 84% coverage: 55:348/352 of query aligns to 96:454/455 of 8jdxA
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ E96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), W322 (vs. gap), E413 (≠ S311), H414 (= H312), N450 (= N344)
- binding 3-methyl-2-oxobutanoic acid: R318 (vs. gap), H369 (≠ N268), H376 (≠ P275), H414 (= H312)
- binding manganese (ii) ion: H369 (≠ N268), H376 (≠ P275), E413 (≠ S311)
Sites not aligning to the query:
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
25% identity, 84% coverage: 55:348/352 of query aligns to 96:455/456 of 8jdsA
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ E96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), W323 (vs. gap), E414 (≠ S311), H415 (= H312), N451 (= N344)
- binding manganese (ii) ion: H370 (≠ N268), H377 (≠ P275), E414 (≠ S311)
- binding pyruvic acid: R319 (vs. gap), H370 (≠ N268), H377 (≠ P275), H415 (= H312)
Sites not aligning to the query:
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
24% identity, 84% coverage: 55:348/352 of query aligns to 96:454/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (≠ L246), H369 (≠ N268), H376 (≠ P275), H414 (= H312)
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ E96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), W322 (vs. gap), E413 (≠ S311), H414 (= H312), N450 (= N344)
- binding manganese (ii) ion: H369 (≠ N268), H376 (≠ P275), E413 (≠ S311)
Sites not aligning to the query:
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
24% identity, 84% coverage: 55:348/352 of query aligns to 96:454/455 of 8jdeA
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ E96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), W322 (vs. gap), E413 (≠ S311), H414 (= H312), N450 (= N344)
- binding lactic acid: R318 (≠ L246), H369 (≠ N268), H376 (≠ P275), H414 (= H312)
- binding manganese (ii) ion: H369 (≠ N268), H376 (≠ P275), E413 (≠ S311)
Sites not aligning to the query:
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
24% identity, 84% coverage: 55:348/352 of query aligns to 96:454/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (≠ L246), W322 (vs. gap), H369 (≠ N268), H376 (≠ P275), H414 (= H312)
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ E96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), W322 (vs. gap), E413 (≠ S311), N450 (= N344)
- binding manganese (ii) ion: H369 (≠ N268), H376 (≠ P275), E413 (≠ S311)
Sites not aligning to the query:
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 49% coverage: 12:182/352 of query aligns to 51:221/459 of P9WIT1
Sites not aligning to the query:
- 354 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
30% identity, 35% coverage: 55:177/352 of query aligns to 97:218/465 of 3pm9A
- active site: A149 (≠ L108), L159 (≠ S118)
- binding flavin-adenine dinucleotide: L133 (≠ P91), G134 (≠ P92), A135 (≠ S93), C139 (≠ A98), T140 (= T99), G142 (= G101), G143 (= G102), S146 (≠ A105), T147 (≠ A106), A149 (≠ L108), G150 (≠ S109), E200 (≠ F159), G201 (= G160), I205 (≠ V164), I206 (= I165)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 69, 70, 71, 72, 73, 74, 75, 76, 79, 80, 91, 423
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 43% coverage: 46:195/352 of query aligns to 115:263/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
30% identity, 38% coverage: 46:177/352 of query aligns to 95:225/467 of 6lpnB
- binding flavin-adenine dinucleotide: L140 (≠ P91), A142 (≠ S93), C146 (≠ A98), H147 (≠ T99), G150 (= G102), N151 (≠ M103), A153 (= A105), T154 (≠ A106), G208 (= G160), I212 (≠ V164), I213 (= I165)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 40, 76, 78, 79, 80, 81, 82, 83, 86, 87, 423, 460
Query Sequence
>AO353_21305 FitnessBrowser__pseudo3_N2E3:AO353_21305
MRTEQDRDASAELLEQINQARENATPLRIQGASSKAFLGREVAGEVLDTRVHRGIVSYDP
TELVITARCGTPLRELLAALDAAGQMLPCEPPSFGEDATVGGMIAAGLSGPRRPWAGSAR
DFVLGTRLITGNGKQLRFGGEVMKNVAGYDLSRLLTGSFGCLGVITEVSLKVLPKPRQCL
SISLELDSAHALSKLAEWGQQPLPISAACHDGRQLHLRLEGGEGSVSAAHQRLGGEVLDA
QFWEALNEQQLTFFDEGLPLWRLSLPNNIGPLTLPGEQLIDWAGAQRWLKSEAPNIQSLA
ADLGGHATCYSHGVSDTPFQPLAPALLRYHQQLKAQLDPQGLFNPGRMYAEF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory