Comparing AO353_23370 FitnessBrowser__pseudo3_N2E3:AO353_23370 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00069 Cytochrome c from Guizotia abyssinica (Niger) (Ramtilla)
46% identity, 78% coverage: 25:124/129 of query aligns to 8:107/111 of P00069
Sites not aligning to the query:
1co6A Crystal structure of ferrocytochrome c2 from rhodopseudomonas viridis (see paper)
44% identity, 78% coverage: 27:127/129 of query aligns to 2:101/107 of 1co6A
P00053 Cytochrome c from Cannabis sativa (Hemp) (Marijuana)
45% identity, 77% coverage: 26:124/129 of query aligns to 9:107/111 of P00053
Sites not aligning to the query:
P00067 Cytochrome c from Tropaeolum majus (Common nasturtium) (Indian cress) (see paper)
46% identity, 78% coverage: 25:124/129 of query aligns to 8:107/111 of P00067
Sites not aligning to the query:
P00071 Cytochrome c from Pastinaca sativa (Wild parsnip) (Anethum pastinaca) (see paper)
45% identity, 77% coverage: 26:124/129 of query aligns to 9:107/111 of P00071
Sites not aligning to the query:
P00015 Cytochrome c, testis-specific from Mus musculus (Mouse) (see paper)
45% identity, 77% coverage: 26:124/129 of query aligns to 2:100/105 of P00015
Sites not aligning to the query:
P00052 Cytochrome c from Vigna radiata var. radiata (Mung bean) (Phaseolus aureus) (see paper)
44% identity, 77% coverage: 26:124/129 of query aligns to 9:107/111 of P00052
Sites not aligning to the query:
2aiuA Crystal structure of mouse testicular cytochromE C at 1.6 angstrom (see paper)
45% identity, 77% coverage: 26:124/129 of query aligns to 1:99/104 of 2aiuA
P00066 Cytochrome c from Nigella damascena (Love-in-a-mist) (see paper)
43% identity, 78% coverage: 25:124/129 of query aligns to 8:107/111 of P00066
Sites not aligning to the query:
Q0DI31 Cytochrome c from Oryza sativa subsp. japonica (Rice) (see paper)
44% identity, 77% coverage: 26:124/129 of query aligns to 10:108/112 of Q0DI31
Sites not aligning to the query:
P00051 Cytochrome c from Cucurbita maxima (Pumpkin) (Winter squash) (see paper)
44% identity, 77% coverage: 26:124/129 of query aligns to 9:107/111 of P00051
Sites not aligning to the query:
P00083 Cytochrome c2 from Blastochloris viridis (Rhodopseudomonas viridis) (see 2 papers)
43% identity, 76% coverage: 30:127/129 of query aligns to 25:121/127 of P00083
Sites not aligning to the query:
P68519 Cytochrome c from Crotalus viridis viridis (Prairie rattlesnake) (see paper)
41% identity, 77% coverage: 26:124/129 of query aligns to 2:100/105 of P68519
Sites not aligning to the query:
P68518 Cytochrome c from Crotalus atrox (Western diamondback rattlesnake) (see paper)
41% identity, 77% coverage: 26:124/129 of query aligns to 2:100/105 of P68518
Sites not aligning to the query:
P68517 Cytochrome c from Crotalus adamanteus (Eastern diamondback rattlesnake) (see paper)
41% identity, 77% coverage: 26:124/129 of query aligns to 2:100/105 of P68517
Sites not aligning to the query:
1ccrA Structure of rice ferricytochromE C at 2.0 angstroms resolution (see paper)
44% identity, 77% coverage: 26:124/129 of query aligns to 9:107/111 of 1ccrA
P00028 Cytochrome c from Entosphenus tridentatus (Pacific lamprey) (Lampetra tridentata) (see paper)
44% identity, 77% coverage: 26:124/129 of query aligns to 2:100/105 of P00028
Sites not aligning to the query:
P00074 Cytochrome c from Ginkgo biloba (Ginkgo) (Maidenhair tree) (see paper)
43% identity, 77% coverage: 26:124/129 of query aligns to 9:107/113 of P00074
Sites not aligning to the query:
P00058 Cytochrome c from Gossypium barbadense (Sea-island cotton) (Egyptian cotton) (see paper)
45% identity, 77% coverage: 26:124/129 of query aligns to 9:107/111 of P00058
Sites not aligning to the query:
P00070 Cytochrome c from Helianthus annuus (Common sunflower) (see paper)
44% identity, 78% coverage: 25:125/129 of query aligns to 9:109/112 of P00070
Sites not aligning to the query:
>AO353_23370 FitnessBrowser__pseudo3_N2E3:AO353_23370
LKKAAVLTVALMLNTGVFSTPADAAGDAEAGGKLFNRICGGCHQVGDSARGSFGPQLNGI
FGRHAGSTTDYQYSTAMKSSDVVWTRETLAAYIEAPKKVVPGTRMIFWGISDPEKIENLL
AYLQTFQPQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory