SitesBLAST
Comparing AO353_24515 FitnessBrowser__pseudo3_N2E3:AO353_24515 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
24% identity, 94% coverage: 15:419/432 of query aligns to 6:416/430 of P0AA76
- Y29 (= Y36) binding
- D31 (= D38) mutation to N: Loss of galactonate transport activity.
- R32 (= R39) binding
- Y64 (= Y71) binding
- E118 (= E125) mutation to Q: Loss of galactonate transport activity.
- W358 (vs. gap) binding
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
22% identity, 91% coverage: 28:419/432 of query aligns to 10:397/409 of 6e9nA
P53322 High-affinity nicotinic acid transporter; Nicotinic acid permease from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
23% identity, 65% coverage: 18:297/432 of query aligns to 86:374/534 of P53322
- K283 (≠ D217) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
23% identity, 82% coverage: 65:419/432 of query aligns to 113:471/495 of Q9NRA2
- K136 (≠ R88) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ L133) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ MT 148:149) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- I---L 266:267 (≠ ISREL 223:227) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ AEDDQ 228:232) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (= G286) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (= P292) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- G371 (≠ P320) to V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
25% identity, 91% coverage: 28:419/432 of query aligns to 13:381/393 of 6e9oA
Q9GQQ0 Protein spinster; Protein benchwarmer; Protein diphthong from Drosophila melanogaster (Fruit fly) (see paper)
23% identity, 62% coverage: 7:274/432 of query aligns to 99:347/605 of Q9GQQ0
- E217 (= E125) mutation to K: In bnch(N); leads to storage in yolk spheres during oogenesis and results in widespread accumulation of enlarged lysosomal and late endosomal inclusions.
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
23% identity, 76% coverage: 65:391/432 of query aligns to 113:441/495 of Q8BN82
- H183 (≠ L133) mutation to R: Abolishes sialic acid transporter activity. Does not affect L-aspartate and L-glutamate transporter activity.
Sites not aligning to the query:
- 39 R→C: Completely abolishes L-aspartate and L-glutamate transporter activity. Retains appreciable H(+)-coupled sialic acid transporter activity.
6zguA Crystal structure of a mfs transporter with bound 3-(2-methylphenyl) propanoic acid at 2.41 angstroem resolution
24% identity, 77% coverage: 73:403/432 of query aligns to 56:366/404 of 6zguA
Sites not aligning to the query:
6zgtA Crystal structure of a mfs transporter with bound 2-naphthoic acid at 2.39 angstroem resolution
24% identity, 77% coverage: 73:403/432 of query aligns to 56:366/404 of 6zgtA
Sites not aligning to the query:
6zgsA Crystal structure of a mfs transporter with bound 3-phenylpropanoic acid at 2.39 angstroem resolution
24% identity, 77% coverage: 73:403/432 of query aligns to 56:366/404 of 6zgsA
Sites not aligning to the query:
6g9xA Crystal structure of a mfs transporter at 2.54 angstroem resolution (see paper)
23% identity, 77% coverage: 73:403/432 of query aligns to 53:358/396 of 6g9xA
6zgrA Crystal structure of a mfs transporter with bound 1- hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution
22% identity, 85% coverage: 36:403/432 of query aligns to 28:361/399 of 6zgrA
A0LNN5 L-lactate transporter; SfMCT from Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) (see paper)
25% identity, 77% coverage: 73:403/432 of query aligns to 62:382/412 of A0LNN5
- Y119 (= Y135) binding ; mutation Y->A,F: Loss of transport activity.
- L145 (≠ I156) mutation to A: Strong decrease in transport activity.
- H250 (≠ W269) mutation to A: Strong decrease in transport activity.; mutation to F: Loss of transport activity.
- R256 (= R275) mutation to A: No change in transport activity.; mutation to D: Increases transport activity.
- D257 (≠ N276) mutation to A: Loss of transport activity.
- N276 (≠ C295) mutation to A: Loss of transport activity.
- R280 (≠ M300) binding ; mutation to A: Abolishes L-lactate binding and L-lactate transport.
- Y331 (≠ A355) mutation to A: Loss of transport activity.; mutation to F: No change in transport activity.
- F335 (= F359) mutation to A: Increases transport activity.
- F359 (≠ N380) mutation to A: Loss of transport activity.
- C362 (≠ A383) mutation to A: Decrease in transport activity.
- K377 (≠ T398) mutation K->A,D: No change in transport activity.
- D378 (≠ T399) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 28 L→A: Loss of transport activity.
- 383 Y→A: Loss of transport activity.; Y→F: Strong decrease in transport activity.
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
23% identity, 76% coverage: 65:391/432 of query aligns to 113:441/495 of Q5Q0U0
- K136 (≠ A92) mutation to E: Markedly decreases H(+)-coupled sialic acid transporter activity.
- R168 (= R118) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ L121) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (= G122) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (= E125) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (≠ A126) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (≠ A129) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (= P130) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ L133) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ L136) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSLKN 268:272 (≠ RELAE 225:229) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
- P334 (= P292) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- G371 (≠ P320) mutation to V: Remains in the endoplasmic reticulum.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R→C: Markedly decreases H(+)-coupled sialic acid transporter activity.
Q9C0U9 Uncharacterized transporter PB1C11.03 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
20% identity, 47% coverage: 19:220/432 of query aligns to 93:296/570 of Q9C0U9
Sites not aligning to the query:
- 14 modified: Phosphoserine
6zgrB Crystal structure of a mfs transporter with bound 1- hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution
22% identity, 85% coverage: 36:403/432 of query aligns to 24:339/364 of 6zgrB
6g9xB Crystal structure of a mfs transporter at 2.54 angstroem resolution (see paper)
22% identity, 85% coverage: 36:403/432 of query aligns to 24:340/368 of 6g9xB
Sites not aligning to the query:
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
22% identity, 83% coverage: 5:364/432 of query aligns to 11:383/448 of Q51955
- D41 (= D38) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (≠ N41) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (≠ N79) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (≠ H83) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G86) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R118) mutation to A: Abolishes 4-HBA transport.
- E144 (≠ Y138) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ Q184) mutation to A: Decrease in 4-HBA transport and chemotaxis.
- D323 (= D308) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- H328 (≠ R313) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to R: Decrease in 4-HBA transport and loss of chemotaxis.
Sites not aligning to the query:
- 386 R→A: Strong decrease in 4-HBA transport.
- 398 R→A: Abolishes 4-HBA transport.
- 444 H→A: No change in 4-HBA transport and chemotaxis.
6zguB Crystal structure of a mfs transporter with bound 3-(2-methylphenyl) propanoic acid at 2.41 angstroem resolution
23% identity, 77% coverage: 73:403/432 of query aligns to 50:340/364 of 6zguB
Sites not aligning to the query:
6zgtB Crystal structure of a mfs transporter with bound 2-naphthoic acid at 2.39 angstroem resolution
23% identity, 77% coverage: 73:403/432 of query aligns to 50:340/364 of 6zgtB
Sites not aligning to the query:
Query Sequence
>AO353_24515 FitnessBrowser__pseudo3_N2E3:AO353_24515
MTTLSLEAVSTVRSNAYRKTAWRLMPFLMLCYLCAYLDRVNVGFAKLQMMNDLALSETVY
GLGAGMFFIGYFLCEVPSNIILHKVGARVWIARIMITWGIVSALFAFVETAWQFYALRFL
LGIAEAGLAPGLLLYLTYWFPSYRRARMTVLWFIAIPLSGMVGGPLSGWIMNHFAGMHGW
AGWQWMFVLEAVPTVLIGLLVLSYLKDGVHQASWLDDDEKALISRELAEDDQQKVTHASV
GEFIRDRRLWLLAGIYFCVVMGQYAITFWLPTLVRNAGVSNPLHIGFLSSLPYLCAIAAM
LYAGRSGDKHRERRWHLIVPMIAGAIGLSLAALMGGNVLLSILSLCLAASGILSATSMFW
MLPTTLLGGVSAAAGIAAVNSFANLAGFCSPYLIGWVTTQTGSSAIGMYLITGVLLFGAT
LVLRIPAASVNR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory