SitesBLAST
Comparing AO353_25115 FitnessBrowser__pseudo3_N2E3:AO353_25115 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6jahA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with glucose (see paper)
45% identity, 95% coverage: 20:423/424 of query aligns to 2:402/404 of 6jahA
- binding (2S)-heptane-1,2,7-triol: Y309 (≠ A330), E310 (≠ Q331), K313 (= K334), R332 (≠ P353)
- binding propane-2,2-diol: D160 (= D181), W162 (= W183)
- binding alpha-D-glucopyranose: D68 (= D90), D116 (= D138), G173 (= G194), E228 (= E249), W246 (= W267), G283 (= G304), G284 (= G305), W285 (= W306), R354 (= R375)
6jagA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with sucrose (see paper)
45% identity, 95% coverage: 20:423/424 of query aligns to 2:402/404 of 6jagA
- binding beta-D-fructofuranose: D9 (= D27), R47 (= R69), F114 (= F136), D116 (= D138), E228 (= E249), W246 (= W267), W285 (= W306), R321 (≠ Y342)
- binding alpha-D-glucopyranose: D68 (= D90), D116 (= D138), G173 (= G194), E228 (= E249), W246 (= W267), G283 (= G304), G284 (= G305), W285 (= W306), R354 (= R375)
6jadA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with palatinose (see paper)
45% identity, 95% coverage: 20:423/424 of query aligns to 2:402/404 of 6jadA
- binding alpha-D-glucopyranose: D68 (= D90), D116 (= D138), G173 (= G194), E228 (= E249), W246 (= W267), G283 (= G304), G284 (= G305), W285 (= W306), R354 (= R375)
- binding alpha-D-fructofuranose: D9 (= D27), R47 (= R69), F114 (= F136), D116 (= D138), Y248 (= Y269), W285 (= W306)
6j9yA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with maltose (see paper)
45% identity, 95% coverage: 20:423/424 of query aligns to 2:402/404 of 6j9yA
- binding carbonate ion: E373 (≠ R394), K382 (≠ L403), D390 (≠ E411)
- binding alpha-D-glucopyranose: D9 (= D27), A42 (≠ N64), R47 (= R69), D68 (= D90), D116 (= D138), D116 (= D138), G173 (= G194), E228 (= E249), W246 (= W267), G283 (= G304), G284 (= G305), W285 (= W306), W285 (= W306), R321 (≠ Y342), R354 (= R375)
6jamA Crystal structure of abc transporter alpha-glycoside-binding mutant protein r356a in complex with trehalose (see paper)
45% identity, 95% coverage: 20:423/424 of query aligns to 4:404/406 of 6jamA
- binding alpha-D-glucopyranose: D11 (= D27), T46 (≠ A66), R49 (= R69), D70 (= D90), F116 (= F136), D118 (= D138), D118 (= D138), G175 (= G194), E230 (= E249), W248 (= W267), Y250 (= Y269), G285 (= G304), G286 (= G305), W287 (= W306), W287 (= W306)
6jaiA Crystal structure of abc transporter alpha-glycoside-binding mutant protein d118a in complex with maltose (see paper)
45% identity, 95% coverage: 20:423/424 of query aligns to 2:402/404 of 6jaiA
- binding calcium ion: P247 (= P268), Y248 (= Y269), R321 (≠ Y342)
- binding alpha-D-glucopyranose: V13 (= V35), T44 (≠ A66), D68 (= D90), G173 (= G194), E228 (= E249), W246 (= W267), G283 (= G304), G284 (= G305), W285 (= W306), W285 (= W306), R321 (≠ Y342), R354 (= R375)
6jb0A Crystal structure of abc transporter alpha-glycoside-binding mutant protein w287a in complex with trehalose (see paper)
45% identity, 95% coverage: 20:423/424 of query aligns to 2:402/404 of 6jb0A
- binding alpha-D-glucopyranose: D9 (= D27), T44 (≠ A66), R47 (= R69), D68 (= D90), F114 (= F136), D116 (= D138), D116 (= D138), G173 (= G194), E228 (= E249), W246 (= W267), W246 (= W267), Y248 (= Y269), G283 (= G304), G284 (= G305), R354 (= R375)
- binding 1,3-propandiol: E15 (≠ A37), R318 (≠ I339)
6dtqA Maltose bound t. Maritima male3 (see paper)
38% identity, 92% coverage: 25:416/424 of query aligns to 1:387/391 of 6dtqA
- binding alpha-D-glucopyranose: V11 (= V35), E14 (= E38), R46 (= R69), D67 (= D90), D115 (= D138), D115 (= D138), G166 (= G194), E222 (= E249), W240 (= W267), W240 (= W267), G277 (= G305), W278 (= W306), W278 (= W306), Q316 (≠ Y342), R349 (= R375)
- binding magnesium ion: T59 (= T82), D60 (= D83), D62 (= D85), E290 (≠ H316)
7qhvAAA Sulfoquinovosyl binding protein (see paper)
33% identity, 88% coverage: 50:421/424 of query aligns to 26:386/390 of 7qhvAAA
- binding [(2~{S},3~{S},4~{S},5~{R},6~{S})-6-[(2~{S})-3-butanoyloxy-2-heptanoyloxy-propoxy]-3,4,5-tris(oxidanyl)oxan-2-yl]methanesulfonic acid: N40 (= N64), T41 (≠ S65), S42 (≠ A66), D66 (= D90), F109 (= F136), D111 (= D138), E163 (= E193), G164 (= G194), A217 (≠ T248), T218 (≠ E249), D219 (≠ E250), W236 (= W267), G272 (= G304), G273 (= G305), W274 (= W306), R343 (= R375)
Sites not aligning to the query:
A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
33% identity, 88% coverage: 50:421/424 of query aligns to 55:416/416 of A9CEY9
- S71 (≠ A66) binding
- D95 (= D90) binding
- D141 (= D138) binding
- G194 (= G194) binding
- T248 (≠ E249) binding
- G303 (= G305) binding ; binding
- W304 (= W306) binding ; binding
- R373 (= R375) binding ; binding
Sites not aligning to the query:
7ofyA Crystal structure of sq binding protein from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) (see paper)
33% identity, 88% coverage: 50:421/424 of query aligns to 27:388/389 of 7ofyA
- binding [(2S,3S,4S,5R,6S)-6-[(2R)-2,3-bis(oxidanyl)propoxy]-3,4,5-tris(oxidanyl)oxan-2-yl]methanesulfonic acid: T42 (≠ S65), S43 (≠ A66), D67 (= D90), D113 (= D138), G166 (= G194), T220 (≠ E249), W238 (= W267), Y240 (= Y269), G274 (= G304), G275 (= G305), W276 (= W306), R345 (= R375)
Sites not aligning to the query:
7yzsAAA Sulfoquinovosyl binding protein (see paper)
33% identity, 87% coverage: 50:419/424 of query aligns to 25:384/384 of 7yzsAAA
- binding 6-deoxy-6-sulfo-beta-D-glucopyranose: T40 (≠ S65), S41 (≠ A66), D65 (= D90), D111 (= D138), E163 (= E193), G164 (= G194), T218 (≠ E249), W236 (= W267), G272 (= G304), G273 (= G305), W274 (= W306), R343 (= R375)
Sites not aligning to the query:
1eu8A Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
32% identity, 93% coverage: 28:422/424 of query aligns to 6:407/407 of 1eu8A
- binding alpha-D-glucopyranose: G12 (≠ A34), E16 (= E38), T43 (≠ N64), T45 (≠ A66), R48 (= R69), D69 (= D90), Y120 (≠ F136), D122 (= D138), G178 (= G194), E238 (= E249), W256 (= W267), Y258 (= Y269), G292 (= G304), G293 (= G305), W294 (= W306), R363 (= R375)
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
33% identity, 87% coverage: 50:419/424 of query aligns to 24:381/382 of 7yzuA
- binding [(2S,3S,4S,5R,6S)-6-methoxy-3,4,5-tris(oxidanyl)oxan-2-yl]methanesulfonic acid: T39 (≠ S65), S40 (≠ A66), D64 (= D90), D110 (= D138), E162 (= E193), G163 (= G194), T215 (≠ E249), W233 (= W267), G269 (= G304), G270 (= G305), W271 (= W306), R340 (= R375)
Sites not aligning to the query:
Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see paper)
31% identity, 93% coverage: 28:422/424 of query aligns to 47:448/450 of Q7LYW7
- E57 (= E38) binding
- T84 (≠ N64) binding
- R89 (= R69) binding
- D110 (= D90) binding
- Y161 (≠ F136) binding
- D163 (= D138) binding
- Y217 (= Y192) binding
- E279 (= E249) binding
- W297 (= W267) binding
- Y299 (= Y269) binding
- G334 (= G305) binding
- W335 (= W306) binding
- W371 (≠ Y342) binding
- R404 (= R375) binding
G7CES0 Trehalose-binding lipoprotein LpqY; Extracellular solute-binding protein; SugABC transporter substrate-binding protein LpqY; SugABC transporter SBP LpqY from Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) (Mycobacterium thermoresistibile) (see paper)
26% identity, 76% coverage: 57:378/424 of query aligns to 67:427/471 of G7CES0
- Q79 (≠ E68) binding ; mutation to A: About 10-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.
- D100 (= D90) binding ; mutation to A: Structurally unstable.
- N154 (≠ D138) binding ; mutation to A: About 100-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.
- Y198 (= Y192) binding
- E261 (= E249) mutation to A: Loss of trehalose-binding.
- W279 (= W267) binding ; mutation to A: Loss of trehalose-binding.
- Y281 (= Y269) binding
- G354 (= G305) binding
- L355 (≠ W306) mutation to A: About 13-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.
- C375 (≠ Y326) modified: Disulfide link with 57
- R424 (= R375) binding ; mutation to A: Loss of trehalose-binding.
Sites not aligning to the query:
- 45 binding ; N→A: About 3-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.; N→T: Increased trehalose-binding; when associated with D-46.
- 46 binding ; E→A: About 3-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.; E→D: Increased trehalose-binding; when associated with T-45.
- 57 modified: Disulfide link with 375
7apeA Crystal structure of lpqy from mycobacterium thermoresistible in complex with trehalose (see paper)
26% identity, 76% coverage: 57:378/424 of query aligns to 34:394/435 of 7apeA
Sites not aligning to the query:
5iaiA Crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol
24% identity, 79% coverage: 85:419/424 of query aligns to 62:398/399 of 5iaiA
Sites not aligning to the query:
8jabA Crystal structure of mycobacterium tuberculosis lpqy in complex with trehalose analogue yb-06
26% identity, 75% coverage: 60:378/424 of query aligns to 36:393/433 of 8jabA
- binding (2~{S},3~{S},4~{R},5~{S},6~{R})-2-(fluoranylmethyl)-6-[(2~{R},3~{R},4~{S},5~{S},6~{S})-6-(fluoranylmethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-oxane-3,4,5-triol: D66 (= D90), N120 (≠ D138), E165 (= E193), W245 (= W267), F247 (≠ Y269), G320 (= G305), R390 (= R375)
Sites not aligning to the query:
- binding (2~{S},3~{S},4~{R},5~{S},6~{R})-2-(fluoranylmethyl)-6-[(2~{R},3~{R},4~{S},5~{S},6~{S})-6-(fluoranylmethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-oxane-3,4,5-triol: 9, 11, 12
8jadA Crystal structure of mycobacterium tuberculosis lpqy in complex with trehalose analogue yb-17
26% identity, 75% coverage: 60:378/424 of query aligns to 36:393/434 of 8jadA
Sites not aligning to the query:
Query Sequence
>AO353_25115 FitnessBrowser__pseudo3_N2E3:AO353_25115
MKQLKTLLPAALLTLFAGLPSVSSAADLTISCGAVGAELQLCKEAVEAWSKQTGNNVEVV
STPNSATERLSFYQQILSAQSTDIDIIQIDMVWPGMLAKHLMDLREVLPANATQGYFQAQ
VDNATVNGRLVTMPWFTDSGLLYYRKDLLEKYNKQVPQTWEEMTATARDVQQAERNAGNP
DVWGYIFQGRAYEGLTCNALEWISSQPEGGLVNPRGDIVVNSQASRAALTLAKSWVGDIS
PRGVLNYTEEEGRGVFQSGNALFMRNWPYVWALVQSQNSAVKDKVGVAPLPRGGETGNHA
STLGGWGLAVSRYSAHPKLAADLVSYLTSAQQQKHRALIGAYNPVIESLYQDPELLAAMP
YYGQLHSILNDGVMRPASITADRYPRVSNAFFDRVHGVLAGELPVDQALAELESELTRIK
RRNW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory