SitesBLAST
Comparing AO356_01095 FitnessBrowser__pseudo5_N2C3_1:AO356_01095 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
32% identity, 48% coverage: 15:184/352 of query aligns to 55:228/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ I29), G75 (= G31), S76 (= S32), G77 (≠ N33), T78 (≠ S34), G79 (≠ A36), L80 (≠ F37), A83 (≠ R40), C84 (≠ E41), P137 (= P91), G138 (≠ P92), E139 (≠ A93), A142 (= A98), T143 (= T99), G146 (= G102), N147 (≠ M103), S149 (≠ A105), T150 (≠ A106), A152 (≠ L108), G153 (≠ S109), E203 (≠ F159), G204 (= G160), I209 (= I165)
Sites not aligning to the query:
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
23% identity, 84% coverage: 55:348/352 of query aligns to 96:454/455 of 8jdxA
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ D96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), W322 (≠ F253), E413 (≠ Q312), H414 (vs. gap), N450 (= N344)
- binding 3-methyl-2-oxobutanoic acid: R318 (vs. gap), H369 (= H268), H376 (≠ P275), H414 (vs. gap)
- binding manganese (ii) ion: H369 (= H268), H376 (≠ P275), E413 (≠ Q312)
Sites not aligning to the query:
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 46% coverage: 20:182/352 of query aligns to 59:221/459 of P9WIT1
Sites not aligning to the query:
- 354 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
23% identity, 84% coverage: 55:348/352 of query aligns to 96:454/455 of 8jdpA
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ D96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), H369 (= H268), E413 (≠ Q312), N450 (= N344)
- binding deaminohydroxyvaline: R319 (vs. gap), H414 (vs. gap)
Sites not aligning to the query:
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
32% identity, 50% coverage: 46:221/352 of query aligns to 94:269/466 of 6lpxA
- binding flavin-adenine dinucleotide: L139 (≠ P91), G140 (≠ P92), A141 (= A93), C145 (≠ A98), G149 (= G102), N150 (≠ M103), A152 (= A105), T153 (≠ A106), G157 (= G110), G207 (= G160), I212 (= I165)
Sites not aligning to the query:
- binding 2-oxoglutaric acid: 333, 337, 348, 379, 381, 388, 423
- binding flavin-adenine dinucleotide: 39, 75, 76, 77, 78, 79, 80, 81, 82, 85, 86, 422, 459
- binding zinc ion: 381, 388, 422
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
32% identity, 50% coverage: 46:221/352 of query aligns to 94:269/466 of 6lpuA
- binding flavin-adenine dinucleotide: L139 (≠ P91), G140 (≠ P92), A141 (= A93), C145 (≠ A98), H146 (≠ T99), G148 (= G101), G149 (= G102), N150 (≠ M103), A152 (= A105), T153 (≠ A106), A155 (≠ L108), E206 (≠ F159), G207 (= G160), I211 (≠ V164), I212 (= I165)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 75, 77, 78, 79, 80, 81, 85, 86, 422, 459
- binding (2s)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 423
- binding zinc ion: 381, 388, 422
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
32% identity, 50% coverage: 46:221/352 of query aligns to 94:269/466 of 6lpqA
- binding flavin-adenine dinucleotide: L139 (≠ P91), G140 (≠ P92), A141 (= A93), C145 (≠ A98), H146 (≠ T99), G149 (= G102), N150 (≠ M103), A152 (= A105), T153 (≠ A106), A155 (≠ L108), G157 (= G110), E206 (≠ F159), G207 (= G160), I211 (≠ V164), I212 (= I165)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 75, 77, 78, 79, 80, 81, 85, 86, 422, 459
- binding d-malate: 82, 333, 337, 348, 379, 381, 388, 422, 423
- binding zinc ion: 381, 388, 422
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
32% identity, 50% coverage: 46:221/352 of query aligns to 94:269/466 of 6lppA
- binding flavin-adenine dinucleotide: L139 (≠ P91), G140 (≠ P92), A141 (= A93), C145 (≠ A98), G149 (= G102), N150 (≠ M103), A152 (= A105), T153 (≠ A106), A155 (≠ L108), G157 (= G110), G207 (= G160), I212 (= I165)
Sites not aligning to the query:
- binding (2R)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 390, 423
- binding flavin-adenine dinucleotide: 39, 75, 77, 78, 79, 80, 81, 82, 85, 86, 422, 423
- binding zinc ion: 381, 388, 422
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
32% identity, 50% coverage: 46:221/352 of query aligns to 95:270/467 of 6lpnB
- binding flavin-adenine dinucleotide: L140 (≠ P91), A142 (= A93), C146 (≠ A98), H147 (≠ T99), G150 (= G102), N151 (≠ M103), A153 (= A105), T154 (≠ A106), G208 (= G160), I212 (≠ V164), I213 (= I165)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 40, 76, 78, 79, 80, 81, 82, 83, 86, 87, 423, 460
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
23% identity, 84% coverage: 55:348/352 of query aligns to 96:453/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (vs. gap), W322 (≠ F253), H369 (= H268), H376 (≠ P275), H413 (vs. gap)
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ D96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), W322 (≠ F253), E412 (≠ Q312), H413 (vs. gap), N449 (= N344)
- binding manganese (ii) ion: H369 (= H268), H376 (≠ P275), E412 (≠ Q312)
Sites not aligning to the query:
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
23% identity, 84% coverage: 55:348/352 of query aligns to 96:453/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (vs. gap), W322 (≠ F253), S336 (vs. gap), H369 (= H268), H376 (≠ P275), H413 (vs. gap)
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ D96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), E412 (≠ Q312), N449 (= N344)
- binding manganese (ii) ion: H369 (= H268), H376 (≠ P275), E412 (≠ Q312)
Sites not aligning to the query:
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
34% identity, 43% coverage: 46:196/352 of query aligns to 147:297/521 of Q8N465
- I147 (≠ V46) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ H52) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ T71) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P88) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A105) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ G131) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G133) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 109 S → W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- 127 N → K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- 131 G → V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 375 D → Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- 386 binding ; binding ; binding ; R→A: Loss of catalytic activity.
- 390 binding ; binding ; T→A: Significantly reduced catalytic activity.
- 399 V → M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
- 401 binding ; binding ; K→A: Loss of catalytic activity.
- 419 R → H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- 426 A → T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- 434 binding ; H→A: Loss of catalytic activity.
- 436 G → V: slight reduction in catalytic activity
- 439 N → D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- 441 binding ; H→A: Loss of catalytic activity.
- 443 binding ; N→A: Significantly reduced catalytic activity.
- 444 V → A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- 446 A → V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- 475 binding ; E→A: Loss of catalytic activity.
- 476 binding ; binding ; binding ; H→A: Loss of catalytic activity.
- 477 G → R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
23% identity, 84% coverage: 55:348/352 of query aligns to 96:455/456 of 8jdrA
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ D96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), Y324 (≠ F254), H370 (= H268), E414 (≠ Q312), N451 (= N344)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (vs. gap), W323 (≠ F253), H415 (vs. gap)
Sites not aligning to the query:
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
23% identity, 84% coverage: 55:348/352 of query aligns to 96:455/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (vs. gap), W323 (≠ F253), H370 (= H268), H415 (vs. gap)
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ D96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), H370 (= H268), E414 (≠ Q312), N451 (= N344)
Sites not aligning to the query:
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
23% identity, 84% coverage: 55:348/352 of query aligns to 96:455/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (vs. gap), W323 (≠ F253), H415 (vs. gap)
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ D96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), Y324 (≠ F254), H370 (= H268), E414 (≠ Q312), N451 (= N344)
Sites not aligning to the query:
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
23% identity, 84% coverage: 55:348/352 of query aligns to 96:455/456 of 8jdnA
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ D96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), H370 (= H268), E414 (≠ Q312), N451 (= N344)
- binding (2R)-2-oxidanylpentanoic acid: R319 (vs. gap), W323 (≠ F253), H415 (vs. gap)
Sites not aligning to the query:
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
23% identity, 84% coverage: 55:348/352 of query aligns to 96:455/456 of 8jdgA
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ D96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), H370 (= H268), E414 (≠ Q312), N451 (= N344)
- binding (2R)-2-oxidanylbutanoic acid: R319 (vs. gap), H415 (vs. gap)
Sites not aligning to the query:
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
23% identity, 84% coverage: 55:348/352 of query aligns to 96:455/456 of 8jdbA
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ D96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), Y324 (≠ F254), H370 (= H268), E414 (≠ Q312), N451 (= N344)
- binding (2R)-2-oxidanyloctanoic acid: R319 (vs. gap), W323 (≠ F253), H415 (vs. gap)
Sites not aligning to the query:
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
23% identity, 84% coverage: 55:348/352 of query aligns to 96:454/455 of 8jdeA
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ D96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), W322 (≠ R250), E413 (≠ Q312), H414 (vs. gap), N450 (= N344)
- binding lactic acid: R318 (≠ L246), H369 (= H268), H376 (≠ P275), H414 (vs. gap)
- binding manganese (ii) ion: H369 (= H268), H376 (≠ P275), E413 (≠ Q312)
Sites not aligning to the query:
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
23% identity, 84% coverage: 55:348/352 of query aligns to 96:453/454 of 8jdvA
- binding 2-Ketohexanoic acid: R317 (≠ L246), W321 (≠ R250), H368 (= H268), H375 (≠ P275), H413 (vs. gap)
- binding flavin-adenine dinucleotide: P132 (= P91), G133 (= G95), A134 (≠ D96), G140 (= G102), M141 (= M103), A143 (= A105), T144 (≠ A106), A146 (≠ L108), S147 (= S109), E200 (≠ F159), G201 (= G160), I206 (= I165), W321 (≠ R250), Y322 (≠ L251), E412 (≠ Q312), H413 (vs. gap), N449 (= N344)
- binding manganese (ii) ion: H368 (= H268), H375 (≠ P275), E412 (≠ Q312)
Sites not aligning to the query:
Query Sequence
>AO356_01095 FitnessBrowser__pseudo5_N2C3_1:AO356_01095
MSREADQDASDLLLEQVSRARANATPLRIQGSNSKAFLGREVAGEVLDTRVHRGIVHYDP
TELVITARAGTPLRELLAALEAAGQRLPCEPPAFGDDATVGGMVAAGLSGPRRPWAGSVR
DFVLGTRLISGHGTVLRFGGEVMKNVAGYDLSRLLAGSFGCLGVITEVSLKVLPKPRHSL
SIRLELGSAEALETLAEWGRQPLPISAASHDGDCLHLRLEGGEGSVSAAHQRFGGEVIDD
RYWTALNEHRLAFFDEGLPLWRLSLPNHTGPLTLPGAQLIDWGGAQRWLKTETGTVQALA
HEVGGHATCYRQGASDTPFQPLAPALLRYHRQLKAQLDPLGLFNPGRMYPEL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory