Comparing AO356_02885 FitnessBrowser__pseudo5_N2C3_1:AO356_02885 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
28% identity, 99% coverage: 1:266/268 of query aligns to 1:259/261 of 2xuaH
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
29% identity, 96% coverage: 11:268/268 of query aligns to 17:269/272 of 4uheA
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
29% identity, 96% coverage: 11:268/268 of query aligns to 17:269/274 of 4uhdA
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
29% identity, 96% coverage: 11:268/268 of query aligns to 17:269/278 of 4uhfA
3ia2A Pseudomonas fluorescens esterase complexed to the r-enantiomer of a sulfonate transition state analog (see paper)
29% identity, 99% coverage: 3:267/268 of query aligns to 3:270/271 of 3ia2A
P22862 Arylesterase; Aryl-ester hydrolase; Carboxylic acid perhydrolase; PFE; Putative bromoperoxidase; EC 3.1.1.2; EC 1.-.-.- from Pseudomonas fluorescens (see 5 papers)
29% identity, 99% coverage: 3:267/268 of query aligns to 4:271/272 of P22862
Sites not aligning to the query:
8pi1B Bicyclic incypro pseudomonas fluorescens esterase (see paper)
29% identity, 99% coverage: 3:267/268 of query aligns to 3:270/276 of 8pi1B
Sites not aligning to the query:
3hi4A Switching catalysis from hydrolysis to perhydrolysis in p. Fluorescens esterase (see paper)
29% identity, 99% coverage: 3:267/268 of query aligns to 3:270/271 of 3hi4A
3heaA The l29p/l124i mutation of pseudomonas fluorescens esterase (see paper)
29% identity, 99% coverage: 3:267/268 of query aligns to 3:270/271 of 3heaA
6i8wB Crystal structure of a membrane phospholipase a, a novel bacterial virulence factor (see paper)
26% identity, 94% coverage: 6:256/268 of query aligns to 47:294/310 of 6i8wB
Sites not aligning to the query:
6aumA Crystal structure of human soluble epoxide hydrolase complexed with trans-4-[4-(3-trifluoromethoxyphenyl-l-ureido)-cyclohexyloxy]-benzoic acid. (see paper)
29% identity, 63% coverage: 11:179/268 of query aligns to 249:407/547 of 6aumA
Sites not aligning to the query:
5am5A Ligand complex structure of soluble epoxide hydrolase (see paper)
29% identity, 63% coverage: 11:179/268 of query aligns to 249:407/546 of 5am5A
Sites not aligning to the query:
5am4A Ligand complex structure of soluble epoxide hydrolase (see paper)
29% identity, 63% coverage: 11:179/268 of query aligns to 249:407/546 of 5am4A
Sites not aligning to the query:
5am1A Ligand complex structure of soluble epoxide hydrolase (see paper)
29% identity, 63% coverage: 11:179/268 of query aligns to 249:407/546 of 5am1A
Sites not aligning to the query:
5am0A Ligand complex structure of soluble epoxide hydrolase (see paper)
29% identity, 63% coverage: 11:179/268 of query aligns to 249:407/546 of 5am0A
Sites not aligning to the query:
5alzA Ligand complex structure of soluble epoxide hydrolase (see paper)
29% identity, 63% coverage: 11:179/268 of query aligns to 249:407/546 of 5alzA
Sites not aligning to the query:
5alyA Ligand complex structure of soluble epoxide hydrolase (see paper)
29% identity, 63% coverage: 11:179/268 of query aligns to 249:407/546 of 5alyA
Sites not aligning to the query:
5alxA Ligand complex structure of soluble epoxide hydrolase (see paper)
29% identity, 63% coverage: 11:179/268 of query aligns to 249:407/546 of 5alxA
Sites not aligning to the query:
5alwA Ligand complex structure of soluble epoxide hydrolase (see paper)
29% identity, 63% coverage: 11:179/268 of query aligns to 249:407/546 of 5alwA
Sites not aligning to the query:
5aluA Ligand complex structure of soluble epoxide hydrolase (see paper)
29% identity, 63% coverage: 11:179/268 of query aligns to 249:407/546 of 5aluA
Sites not aligning to the query:
>AO356_02885 FitnessBrowser__pseudo5_N2C3_1:AO356_02885
MPFATIDGQPLHYLDQGQGPVVLLGSSYLWDHSMWAPQIEVLSRDYRVIALDLWGHGQSG
QLPEGMTSLDDLARQALTLMDHLGIDRFNLVGLSVGGMWGARLALAAPERVQTLVLMDTY
VGVEPEPTRQYYFSLFDRIEASGSIPEPLLDIVVPIFFRPGIDPQSALYQQFRATLAALP
TDRLRASIVPLGRIIFGRDDILPRLHALDAKGTVIMCGDQDKPRPPSEAKEMAELIGCPC
LLIPDAGHISNLENPEFVTEALLKVLRS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory